BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30720 (506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0622 - 4658133-4658150,4658269-4658337,4658436-4658462,465... 30 0.93 >02_01_0622 - 4658133-4658150,4658269-4658337,4658436-4658462, 4658808-4658873,4658954-4659076,4659562-4659629, 4659703-4659766,4659994-4660135,4660218-4660306, 4660574-4660637,4660870-4661021,4661124-4661261, 4661742-4661867,4661971-4662183,4662343-4662426, 4662583-4662742,4662993-4663126,4664047-4664136, 4664313-4664471,4665528-4665611,4666170-4666289, 4666338-4666391,4666899-4666945,4667556-4667598, 4667730-4668586,4668845-4668899 Length = 1081 Score = 30.3 bits (65), Expect = 0.93 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 349 SVVRQSLDKFTLYTLVTCRTDTKYFTRLYECYQMQRRRRLQG 224 S VRQ +D + LYT+V KY L Y R+RL+G Sbjct: 687 SFVRQEMDAYRLYTVVPYL--VKYIDNLTNIYVRFNRKRLKG 726 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,334,952 Number of Sequences: 37544 Number of extensions: 202685 Number of successful extensions: 431 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -