BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30719 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1022| Best HMM Match : EspF (HMM E-Value=0.51) 31 1.1 SB_48321| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 >SB_1022| Best HMM Match : EspF (HMM E-Value=0.51) Length = 310 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -1 Query: 671 NLVKKNLIGEILPPNLVIKMGLAKYEEPPSLLMLQL 564 NL++ +L G +PP L I+ LA + PP L+ QL Sbjct: 16 NLIRDHLAGHRIPPQL-IRAQLAGHRVPPQLIRAQL 50 >SB_48321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +2 Query: 101 IKKETDDPVVHVIDATTLTRNHCPXXXXXXXPISLHPTSLASLKTPTTLHL 253 I+ T+D + V+D + N P P H +S A TPT+ H+ Sbjct: 105 IRTRTEDDIAKVLDCSKFRLNPVPPSLDQLLPDVHHDSSSAISATPTSNHI 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,348,869 Number of Sequences: 59808 Number of extensions: 388238 Number of successful extensions: 777 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -