BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30717 (729 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 1.9 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 3.3 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.3 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 5.8 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 175 SFRSNFRSLGTVDKRGADLPLAEHRRSLDIVP-IFASEWVDNLLLNTFFTAL 23 S S+ SL + K A LP+ +H R +VP ++ + + L L +F ++ Sbjct: 2 SLYSSINSLVLISKIFALLPVKKHHRLEKLVPCVYLTSFSVVLSLGSFIVSV 53 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 335 GWLKNGRLSS 364 GWLK G+LSS Sbjct: 124 GWLKKGKLSS 133 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 445 SRSPYW*NQCRRHVERIHRLSSHQC 371 + P+ ++CR R H L H+C Sbjct: 243 NEKPFECDKCRGRFRRRHHLVHHKC 267 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/23 (30%), Positives = 16/23 (69%) Frame = -1 Query: 723 TAFGREVPNQNFEISKNGGLLSN 655 T +G+ P QN+E+ ++ +++N Sbjct: 145 TVYGK--PEQNYEVDESASVMTN 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,531 Number of Sequences: 336 Number of extensions: 3833 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -