BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30714 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 26 0.34 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 7.4 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 9.8 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.8 bits (54), Expect = 0.34 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = -1 Query: 653 PPS*P*GVWTPHTVFWQPRGTANKSAPGPLLSRPLP----ENIRHCFKKL 516 PP P G+ +TV+++P T +K+ P + +P +N+ H K L Sbjct: 1223 PPVEPNGIVEYYTVYYKPVSTDDKTEVKPTSQKIVPNLRNQNLSHQAKNL 1272 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.4 bits (43), Expect = 7.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -1 Query: 566 LLSRPLPENIRHCFKKLREHSIFALNKK*KKCKYYFGL 453 LL RPLP R F+ L+ + + ++ +FGL Sbjct: 138 LLDRPLPAPERPSFEGLKRQNPVKFLRAIEEYGRFFGL 175 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 262 CLIGLVPIITCQRD*NYCHRE 324 CL+G + CQR+ + RE Sbjct: 68 CLVGTPETLRCQREGFFHERE 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,631 Number of Sequences: 336 Number of extensions: 2559 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -