BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30713 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.9 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 6.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +1 Query: 94 FYSSYNFDSSLLKRFFTRCFDSQCYSESELN*R*AAAW 207 F +NFD L + +C+ C + + + AAW Sbjct: 1506 FLEKWNFDGLDLDWEYPKCWQVDCKKGPDSDKQAFAAW 1543 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 97 YSSYNFDSSLLKRFFTRCFDSQCYSESEL 183 Y Y S L FFT +QCY +EL Sbjct: 159 YKYYQILSHLSGIFFTVFNVAQCYLTTEL 187 Score = 21.0 bits (42), Expect = 9.1 Identities = 5/15 (33%), Positives = 12/15 (80%) Frame = -1 Query: 485 FLYKIKLIFEEQEVF 441 FL+ ++++F + E+F Sbjct: 9 FLHSVRIVFVQSEIF 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,749 Number of Sequences: 336 Number of extensions: 3107 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -