BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30709 (627 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15550.2 68418.m01821 transducin family protein / WD-40 repea... 54 6e-08 At5g15550.1 68418.m01820 transducin family protein / WD-40 repea... 54 6e-08 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 49 2e-06 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 48 4e-06 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 48 4e-06 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 44 6e-05 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 44 1e-04 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 43 2e-04 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 42 4e-04 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 42 4e-04 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 42 4e-04 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 41 8e-04 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 41 8e-04 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 40 0.001 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 40 0.001 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 40 0.002 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 39 0.002 At4g02730.1 68417.m00372 transducin family protein / WD-40 repea... 39 0.003 At2g46280.3 68415.m05757 eukaryotic translation initiation facto... 39 0.003 At2g46280.2 68415.m05756 eukaryotic translation initiation facto... 39 0.003 At2g46280.1 68415.m05755 eukaryotic translation initiation facto... 39 0.003 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 38 0.004 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 38 0.004 At3g21060.1 68416.m02662 transducin family protein / WD-40 repea... 38 0.004 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 38 0.005 At2g46290.1 68415.m05758 eukaryotic translation initiation facto... 38 0.005 At4g04940.1 68417.m00718 transducin family protein / WD-40 repea... 36 0.017 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 36 0.017 At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 36 0.017 At5g43930.1 68418.m05374 transducin family protein / WD-40 repea... 36 0.022 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 36 0.022 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 36 0.022 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 36 0.022 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 36 0.022 At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 ... 36 0.029 At3g49180.1 68416.m05375 transducin family protein / WD-40 repea... 36 0.029 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 36 0.029 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 35 0.038 At4g34380.1 68417.m04884 transducin family protein / WD-40 repea... 34 0.067 At1g52730.2 68414.m05959 transducin family protein / WD-40 repea... 34 0.067 At1g52730.1 68414.m05958 transducin family protein / WD-40 repea... 34 0.067 At1g24130.1 68414.m03044 transducin family protein / WD-40 repea... 34 0.067 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 34 0.089 At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 33 0.12 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 33 0.12 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 33 0.12 At5g64730.1 68418.m08140 transducin family protein / WD-40 repea... 33 0.16 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 33 0.16 At1g24530.1 68414.m03088 transducin family protein / WD-40 repea... 33 0.16 At3g50390.1 68416.m05512 transducin family protein / WD-40 repea... 33 0.21 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 33 0.21 At2g25420.1 68415.m03045 transducin family protein / WD-40 repea... 33 0.21 At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec... 33 0.21 At5g64630.3 68418.m08123 transducin family protein / WD-40 repea... 32 0.27 At5g64630.2 68418.m08122 transducin family protein / WD-40 repea... 32 0.27 At5g64630.1 68418.m08121 transducin family protein / WD-40 repea... 32 0.27 At5g56130.1 68418.m07002 transducin family protein / WD-40 repea... 32 0.27 At2g33340.2 68415.m04087 transducin family protein / WD-40 repea... 32 0.27 At2g33340.1 68415.m04086 transducin family protein / WD-40 repea... 32 0.27 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 32 0.27 At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-rel... 32 0.27 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 32 0.36 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 32 0.36 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 32 0.36 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 32 0.36 At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 ... 31 0.47 At4g29830.1 68417.m04246 transducin family protein / WD-40 repea... 31 0.47 At4g00090.1 68417.m00009 transducin family protein / WD-40 repea... 31 0.47 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 31 0.47 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 31 0.47 At3g18950.1 68416.m02405 transducin family protein / WD-40 repea... 31 0.47 At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pf... 31 0.47 At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pf... 31 0.47 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 31 0.47 At5g66240.2 68418.m08345 transducin family protein / WD-40 repea... 31 0.63 At5g66240.1 68418.m08344 transducin family protein / WD-40 repea... 31 0.63 At5g60940.2 68418.m07645 transducin family protein / WD-40 repea... 31 0.63 At5g60940.1 68418.m07644 transducin family protein / WD-40 repea... 31 0.63 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 31 0.63 At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 31 0.63 At2g28290.2 68415.m03434 chromatin remodeling protein, putative ... 31 0.63 At2g28290.1 68415.m03433 chromatin remodeling protein, putative ... 31 0.63 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 31 0.63 At1g71840.1 68414.m08302 transducin family protein / WD-40 repea... 31 0.63 At3g15610.1 68416.m01980 transducin family protein / WD-40 repea... 31 0.83 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 0.83 At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 ... 31 0.83 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 31 0.83 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 31 0.83 At1g49450.1 68414.m05543 transducin family protein / WD-40 repea... 31 0.83 At1g47610.1 68414.m05288 transducin family protein / WD-40 repea... 31 0.83 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 31 0.83 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 30 1.1 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 30 1.1 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 30 1.1 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 30 1.1 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 30 1.1 At1g19750.1 68414.m02469 transducin family protein / WD-40 repea... 30 1.1 At5g27080.1 68418.m03231 WD-40 repeat family protein contains 5 ... 30 1.4 At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta... 30 1.4 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 30 1.4 At2g46560.1 68415.m05808 transducin family protein / WD-40 repea... 30 1.4 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 30 1.4 At1g18830.1 68414.m02345 transducin family protein / WD-40 repea... 30 1.4 At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-rel... 30 1.4 At5g50120.1 68418.m06207 transducin family protein / WD-40 repea... 29 1.9 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 29 1.9 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 29 1.9 At4g35810.1 68417.m05088 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 1.9 At4g28450.1 68417.m04071 transducin family protein / WD-40 repea... 29 1.9 At3g12150.1 68416.m01514 expressed protein 29 1.9 At2g16405.1 68415.m01878 transducin family protein / WD-40 repea... 29 1.9 At1g15470.1 68414.m01860 transducin family protein / WD-40 repea... 29 1.9 At5g14530.1 68418.m01703 transducin family protein / WD-40 repea... 29 2.5 At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ... 29 2.5 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 29 2.5 At2g47010.2 68415.m05873 expressed protein 29 2.5 At2g47010.1 68415.m05872 expressed protein 29 2.5 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 29 2.5 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 29 2.5 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 29 2.5 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 29 2.5 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 29 2.5 At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 29 2.5 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 29 2.5 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 29 2.5 At1g73340.1 68414.m08489 cytochrome P450 family protein similar ... 29 2.5 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 29 2.5 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 29 3.3 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 29 3.3 At3g61250.1 68416.m06855 myb family transcription factor (MYB17)... 29 3.3 At2g26490.1 68415.m03178 transducin family protein / WD-40 repea... 29 3.3 At2g19540.1 68415.m02283 transducin family protein / WD-40 repea... 29 3.3 At1g64350.1 68414.m07292 transducin family protein / WD-40 repea... 29 3.3 At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, ... 28 4.4 At5g19920.1 68418.m02370 transducin family protein / WD-40 repea... 28 4.4 At3g05090.2 68416.m00553 transducin family protein / WD-40 repea... 28 4.4 At3g05090.1 68416.m00552 transducin family protein / WD-40 repea... 28 4.4 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 28 4.4 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 28 4.4 At1g69400.2 68414.m07968 transducin family protein / WD-40 repea... 28 4.4 At1g69400.1 68414.m07969 transducin family protein / WD-40 repea... 28 4.4 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 28 4.4 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 28 4.4 At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 28 4.4 At5g58760.1 68418.m07360 transducin family protein / WD-40 repea... 28 5.8 At4g35050.1 68417.m04974 WD-40 repeat protein (MSI3) contains 5 ... 28 5.8 At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 ... 28 5.8 At1g21650.1 68414.m02710 preprotein translocase secA family prot... 28 5.8 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 27 7.7 At4g32330.2 68417.m04600 expressed protein 27 7.7 At4g32330.1 68417.m04599 expressed protein 27 7.7 >At5g15550.2 68418.m01821 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 402 Score = 54.4 bits (125), Expect = 6e-08 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 2/104 (1%) Frame = +3 Query: 255 YNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITA-SADRHVRLYDP 431 ++ + SS WDH ++ WD + G + KA VD ++++I A +D +R++DP Sbjct: 283 HDVIYSSSWDHSVRRWDVETGKDSLNLFCGKALNTVDVGGESSALIAAGGSDPILRVWDP 342 Query: 432 RST-ESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKLW 560 R S F+SH+ W+ + +W K+ + LW Sbjct: 343 RKPGTSAPVFQFSSHSSWISACKWHKSSWFHLLSASYDGKIMLW 386 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 6/79 (7%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSK------PEHGTT 192 RGH ++ +S GN S SWD + LW+ + + E + K + E + Sbjct: 202 RGHKASVQSVSAQKSGNMVCSSSWDCTINLWNTNESTSEGESVSVKKRKGNNQAEESQSE 261 Query: 193 RNPLTTLKGHKEAISGVQW 249 +T+L GH + +S V W Sbjct: 262 GEAVTSLVGHTQCVSSVVW 280 >At5g15550.1 68418.m01820 transducin family protein / WD-40 repeat family protein similar to YTM1 - Homo sapiens, EMBL:AF242546; contains Pfam PF00400: WD domain, G-beta repeat (7 copies,1 weak); Length = 433 Score = 54.4 bits (125), Expect = 6e-08 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 2/104 (1%) Frame = +3 Query: 255 YNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITA-SADRHVRLYDP 431 ++ + SS WDH ++ WD + G + KA VD ++++I A +D +R++DP Sbjct: 283 HDVIYSSSWDHSVRRWDVETGKDSLNLFCGKALNTVDVGGESSALIAAGGSDPILRVWDP 342 Query: 432 RST-ESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKLW 560 R S F+SH+ W+ + +W K+ + LW Sbjct: 343 RKPGTSAPVFQFSSHSSWISACKWHKSSWFHLLSASYDGKIMLW 386 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 6/79 (7%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSK------PEHGTT 192 RGH ++ +S GN S SWD + LW+ + + E + K + E + Sbjct: 202 RGHKASVQSVSAQKSGNMVCSSSWDCTINLWNTNESTSEGESVSVKKRKGNNQAEESQSE 261 Query: 193 RNPLTTLKGHKEAISGVQW 249 +T+L GH + +S V W Sbjct: 262 GEAVTSLVGHTQCVSSVVW 280 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 49.2 bits (112), Expect = 2e-06 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAF-FDVDWSPLNNSIITASADRHVRLYDPRST 440 ++S G D L+K+WD G + G+K V W+ N ++TAS D+ ++LYD R+ Sbjct: 283 LVSGGKDQLVKLWDTRSGRELCSLHGHKNIVLSVKWNQNGNWLLTASKDQIIKLYDIRTM 342 Query: 441 ESIVKTTFTSHTGWVQSVRW 500 + + +F HT V S+ W Sbjct: 343 KEL--QSFRGHTKDVTSLAW 360 Score = 33.9 bits (74), Expect = 0.089 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 360 VDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSK 506 VDW P + +++ D+ V+L+D RS + + H V SV+W++ Sbjct: 274 VDWHPTKSLLVSGGKDQLVKLWDTRSGREL--CSLHGHKNIVLSVKWNQ 320 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 48.4 bits (110), Expect = 4e-06 Identities = 38/120 (31%), Positives = 53/120 (44%), Gaps = 5/120 (4%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASADRHVR 419 S DG LS WD L++WD G + G+ K V +S N I++AS DR ++ Sbjct: 72 SSDG-QFALSGSWDGELRLWDLATGETTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIK 130 Query: 420 LYDPRSTESIVKTTFTSHTGWVQSVRWSK---TKTLFSFLLDTTTRFKLWGNQGSP-RNS 587 L++ + H WV VR+S T+ S D T K+W Q RNS Sbjct: 131 LWNTLGECKYTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTV--KVWNLQNCKLRNS 188 Score = 33.9 bits (74), Expect = 0.089 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 GH +E + +S+DG SGSWD + LW + E Sbjct: 61 GHSHFVEDVVLSSDGQFALSGSWDGELRLWDLATGE 96 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 261 TVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLYD 428 T++S+ WD +K+W+ ++ + G+ + + V SP + + D + L+D Sbjct: 165 TIVSASWDKTVKVWNLQNCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWD 221 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLW 123 GH + ++VS DG+ ASG D + LW Sbjct: 191 GHSGYLNTVAVSPDGSLCASGGKDGVILLW 220 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 48.4 bits (110), Expect = 4e-06 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 4/120 (3%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASADRHVR 419 S DG LS WD L++WD G + G+ K V +S N I++AS DR ++ Sbjct: 72 SSDG-QFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIK 130 Query: 420 LYDPRSTESIVKTTFTSHTGWVQSVRWSK---TKTLFSFLLDTTTRFKLWGNQGSPRNST 590 L++ + H WV VR+S T+ S D T K+W Q +T Sbjct: 131 LWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTV--KVWNLQNCKLRNT 188 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 GH ++ + +S+DG SGSWD + LW + E Sbjct: 61 GHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGE 96 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 261 TVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLYD 428 T++S+ WD +K+W+ ++ +AG+ + + V SP + + D + L+D Sbjct: 165 TIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWD 221 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 T GH + ++VS DG+ ASG D + LW Sbjct: 188 TLAGHSGYLNTVAVSPDGSLCASGGKDGVILLW 220 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 44.4 bits (100), Expect = 6e-05 Identities = 36/121 (29%), Positives = 52/121 (42%), Gaps = 5/121 (4%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASADRHVR 419 S DG LS WD L++WD G + G+ K V +S N I++AS DR ++ Sbjct: 72 SSDG-QFALSGSWDGELRLWDLAAGVSTRRFVGHTKDVLSVAFSLDNRQIVSASRDRTIK 130 Query: 420 LYDP-RSTESIVKTTFTSHTGWVQSVRWSKT---KTLFSFLLDTTTRFKLWGNQGSPRNS 587 L++ + + H WV VR+S T+ S D T K+W S Sbjct: 131 LWNTLGECKYTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTV--KVWNLSNCKLRS 188 Query: 588 T 590 T Sbjct: 189 T 189 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLW 123 GH +E + +S+DG SGSWD + LW Sbjct: 61 GHSHFVEDVVLSSDGQFALSGSWDGELRLW 90 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 261 TVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLYD 428 T++S+ WD +K+W+ ++ +AG+ + V SP + + D V L+D Sbjct: 166 TIVSASWDKTVKVWNLSNCKLRSTLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLWD 222 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 T GH + ++VS DG+ ASG D V LW Sbjct: 189 TLAGHTGYVSTVAVSPDGSLCASGGKDGVVLLW 221 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 43.6 bits (98), Expect = 1e-04 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 2/100 (2%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVR 419 S DG V+S G D+++K+WD G + E ++ +D+ PL + T SADR V+ Sbjct: 100 SPDG-RWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVK 158 Query: 420 LYDPRSTESIVKTTFTSHTGWVQSVRWSKT-KTLFSFLLD 536 +D + E ++ TT TG V+++ + +TLF L D Sbjct: 159 FWDLETFE-LIGTTRPEATG-VRAIAFHPDGQTLFCGLDD 196 Score = 41.9 bits (94), Expect = 3e-04 Identities = 28/91 (30%), Positives = 41/91 (45%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTR 195 C+ TY+GH +GI + S DG SG DN V +W + A + H P Sbjct: 83 CIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLT-AGKLLHEFKCHEGPIRSLDF 141 Query: 196 NPLTTLKGHKEAISGVQWMDTTQYCPVVGTT 288 +PL L A V++ D + ++GTT Sbjct: 142 HPLEFLLATGSADRTVKFWDLETF-ELIGTT 171 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 42.7 bits (96), Expect = 2e-04 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 1/100 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYDPRST 440 +L+ D +WD KQ+ + DVDW N S T+S D + L + Sbjct: 380 LLTGSVDRTAVVWDVKAEEWKQQFEFHSGPTLDVDWRN-NVSFATSSTDSMIYLC--KIG 436 Query: 441 ESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKLW 560 E+ TFT H G V V+W T +L + D +T K+W Sbjct: 437 ETRPAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTA-KIW 475 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = +3 Query: 261 TVLSSGWDHLLKIWDCDLGGIKQEIAGNK-AFFDVDWSPLNNSIITASADRHVRLYDPRS 437 T+ S+ +D +K+WD +LG + G++ + + +SP I + S D+ + ++ + Sbjct: 513 TLASASFDSTVKLWDAELGKMLCSFNGHREPVYSLAFSPNGEYIASGSLDKSIHIWSIKE 572 Query: 438 TESIVKTTFTSHTGWVQSVRWSK 506 + IVK T+T + G + V W+K Sbjct: 573 GK-IVK-TYTGN-GGIFEVCWNK 592 Score = 33.9 bits (74), Expect = 0.089 Identities = 18/57 (31%), Positives = 24/57 (42%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITASADRHVRLYDPR 434 + S D + IW G I + GN F+V W+ N I AD V + D R Sbjct: 556 IASGSLDKSIHIWSIKEGKIVKTYTGNGGIFEVCWNKEGNKIAACFADNSVCVLDFR 612 Score = 31.5 bits (68), Expect = 0.47 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 + ++ GH + + L+ S +G ASGS D ++ +WS Sbjct: 534 LCSFNGHREPVYSLAFSPNGEYIASGSLDKSIHIWS 569 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 41.5 bits (93), Expect = 4e-04 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +3 Query: 246 MDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRL 422 +DG ++SS D L++WD + Q ++G+ + + VD P ++T SAD+ +R Sbjct: 157 LDGGKKLVSSSKDKFLRVWDLETQHCMQIVSGHHSEVWSVDTDPEERYVVTGSADQELRF 216 Query: 423 Y 425 Y Sbjct: 217 Y 217 Score = 33.9 bits (74), Expect = 0.089 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 +S+ ++ GH + C+ +S+DG +GS D N+ +W + Sbjct: 570 DSLKFYLSLYGHKLPVMCIDISSDGELIVTGSQDKNLKIWGLDFGD 615 Score = 32.3 bits (70), Expect = 0.27 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 C + + H + L + G+ ASGS DN++ LW Sbjct: 98 CEVNFNSHKGAVTALRYNKVGSMLASGSKDNDIILW 133 Score = 30.7 bits (66), Expect = 0.83 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 ++T GH I CL++S G+ +GS D ++ W S Sbjct: 659 LLTLEGHHAEIWCLAISNRGDFLVTGSHDRSMRRWDRS 696 Score = 27.5 bits (58), Expect = 7.7 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYDPRST 440 + S G D L+K WD D + G+ A + + S + ++T S DR +R +D RS Sbjct: 639 LFSIGKDRLVKYWDADKFEHLLTLEGHHAEIWCLAISNRGDFLVTGSHDRSMRRWD-RSE 697 Query: 441 E 443 E Sbjct: 698 E 698 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 41.5 bits (93), Expect = 4e-04 Identities = 34/90 (37%), Positives = 44/90 (48%), Gaps = 8/90 (8%) Frame = +3 Query: 270 SSGWDHLLKIWDCDLGG---IKQEIAGNKAFFDVDWSPLN-NSIITASADRHVRLYDPRS 437 S G D L +WD G K E A + VDW+P + N I+T SAD VRL+D R Sbjct: 310 SVGDDSCLILWDARTGTNPVTKVEKAHDADLHCVDWNPHDDNLILTGSADNTVRLFDRRK 369 Query: 438 -TESIVKT---TFTSHTGWVQSVRWSKTKT 515 T + V + F H V V+WS K+ Sbjct: 370 LTANGVGSPIYKFEGHKAAVLCVQWSPDKS 399 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 41.5 bits (93), Expect = 4e-04 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 NS CM TY GH K + + S DG++F + +D N+ W + Sbjct: 314 NSGKCMRTYMGHAKAVRDICFSNDGSKFLTAGYDKNIKYWDTETGQ 359 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 3/87 (3%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSP---LNNSIITASADRH 413 S DG + L++G+D +K WD + G + + K + V +P N ++ +D+ Sbjct: 335 SNDG-SKFLTAGYDKNIKYWDTETGQVISTFSTGKIPYVVKLNPDDDKQNILLAGMSDKK 393 Query: 414 VRLYDPRSTESIVKTTFTSHTGWVQSV 494 + +D + E V + H G V ++ Sbjct: 394 IVQWDINTGE--VTQEYDQHLGAVNTI 418 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 40.7 bits (91), Expect = 8e-04 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASADRHVRLY 425 +LS D LKIW+ +KQ++ G+ F VDWSP +++ DR ++L+ Sbjct: 417 LLSGSKDSTLKIWEIRTKKLKQDLPGHADEVFAVDWSPDGEKVVSGGKDRVLKLW 471 Score = 40.3 bits (90), Expect = 0.001 Identities = 27/78 (34%), Positives = 32/78 (41%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTR 195 C T GH + + C+S S DG + ASGS D V LW T Sbjct: 101 CSQTIAGHAEAVLCVSFSPDGKQLASGSGDTTVRLWDL-------------------YTE 141 Query: 196 NPLTTLKGHKEAISGVQW 249 PL T KGHK + V W Sbjct: 142 TPLFTCKGHKNWVLTVAW 159 Score = 37.5 bits (83), Expect = 0.007 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRN 198 + T +GH + ++ S DG SGS +C W+ E E P T K G + Sbjct: 144 LFTCKGHKNWVLTVAWSPDGKHLVSGSKSGEICCWNPKKGELEGSPLTGHKKWITGISWE 203 Query: 199 PL 204 P+ Sbjct: 204 PV 205 Score = 36.7 bits (81), Expect = 0.013 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 3/125 (2%) Frame = +3 Query: 195 KSTDHFKRTQGGYLGCSMDGYNTVLSSGWDHLLKIWDCDLGGI-KQEIAGNKAFFD-VDW 368 K+ + + +T+G D ++S D + +W+ + K+ + G++ + V + Sbjct: 316 KALERYNKTKG-------DSPERLVSGSDDFTMFLWEPSVSKQPKKRLTGHQQLVNHVYF 368 Query: 369 SPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWS-KTKTLFSFLLDTTT 545 SP I +AS D+ VRL++ + + + T F H G V V WS ++ L S D+T Sbjct: 369 SPDGKWIASASFDKSVRLWNGITGQFV--TVFRGHVGPVYQVSWSADSRLLLSGSKDST- 425 Query: 546 RFKLW 560 K+W Sbjct: 426 -LKIW 429 Score = 33.5 bits (73), Expect = 0.12 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 327 QEIAGN-KAFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWS 503 Q IAG+ +A V +SP + + S D VRL+D TE+ + T H WV +V WS Sbjct: 103 QTIAGHAEAVLCVSFSPDGKQLASGSGDTTVRLWD-LYTETPL-FTCKGHKNWVLTVAWS 160 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 GH + + + S DG AS S+D +V LW+ Sbjct: 358 GHQQLVNHVYFSPDGKWIASASFDKSVRLWN 388 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 40.7 bits (91), Expect = 8e-04 Identities = 27/78 (34%), Positives = 39/78 (50%) Frame = +3 Query: 270 SSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITASADRHVRLYDPRSTESI 449 S D +IW D + +AG+ + DVDW P N I T S+D+ VRL+D ++ E + Sbjct: 477 SCSHDRTARIWSMDRIQPLRIMAGHLS--DVDWHPNCNYIATGSSDKTVRLWDVQTGECV 534 Query: 450 VKTTFTSHTGWVQSVRWS 503 F H V S+ S Sbjct: 535 --RIFIGHRSMVLSLAMS 550 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 13 DCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLA 138 +C+ + GH + L++S DG ASG D + +W S A Sbjct: 532 ECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTA 573 Score = 32.3 bits (70), Expect = 0.27 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 C+ GH+ + LS S +G+ ASGS D V LW + Sbjct: 575 CITPLMGHNSCVWSLSYSGEGSLLASGSADCTVKLWDVT 613 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 T+ G+ C S+S DG+ A G D+++ +W Sbjct: 347 TFVNTHNGLNCSSISHDGSLVAGGFSDSSIKVW 379 Score = 27.5 bits (58), Expect = 7.7 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 2/96 (2%) Frame = +3 Query: 234 LGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAG-NKAFFDVDWSPLNNSIITASADR 410 L S DG + S D + +WD + G N + + +S + + + SAD Sbjct: 547 LAMSPDG-RYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLSYSGEGSLLASGSADC 605 Query: 411 HVRLYDPRSTESIVKT-TFTSHTGWVQSVRWSKTKT 515 V+L+D S+ + K ++ ++S+R TK+ Sbjct: 606 TVKLWDVTSSTKLTKAEEKNGNSNRLRSLRTFPTKS 641 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 10 VDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 +D + H I CL +SADG+ +GSWD+N+ +W+ Sbjct: 269 LDLGLQQDSHRNRISCLGLSADGSALCTGSWDSNLKIWA 307 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 10 VDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 +D + H I CL +SADG+ +GSWD+N+ +W+ Sbjct: 331 LDLGLQQDSHRNRISCLGLSADGSALCTGSWDSNLKIWA 369 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENH 153 C T +GH + L + + NR S S D + +W+A L ++ H Sbjct: 57 CCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNA-LTSQKTH 101 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAG-NKAFFDVDWSPLNNSIITASADRHVR 419 S+DG TV S D L++WD G + E+AG + A V S N I+T+ D Sbjct: 366 SIDGL-TVFSGHMDGNLRLWDIQTGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDNVHN 424 Query: 420 LYDPRSTE 443 ++D R+ E Sbjct: 425 VFDTRTLE 432 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 39.1 bits (87), Expect = 0.002 Identities = 26/91 (28%), Positives = 41/91 (45%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTR 195 C+ TY+GH +GI + + DG SG DN V +W + A + H P Sbjct: 134 CIQTYKGHSRGISTIRFTPDGRWVVSGGLDNVVKVWDLT-AGKLLHEFKFHEGPIRSLDF 192 Query: 196 NPLTTLKGHKEAISGVQWMDTTQYCPVVGTT 288 +PL L A V++ D + ++G+T Sbjct: 193 HPLEFLLATGSADRTVKFWDLETF-ELIGST 222 >At4g02730.1 68417.m00372 transducin family protein / WD-40 repeat family protein similar to C. elegans putative WD-repeat protein C14B1.4 (SP:Q17963) Length = 333 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 T GH I C+ S DGN AS S D + LWSA+ Sbjct: 38 TLEGHTAAISCVKFSNDGNLLASASVDKTMILWSAT 73 Score = 34.3 bits (75), Expect = 0.067 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 1 RNSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 R+ +C+ RGH + C++ + N SGS+D + +W Sbjct: 115 RSPYECLKVLRGHTNFVFCVNFNPPSNLIVSGSFDETIRIW 155 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSA 129 Y GH GI L+ S+D + S S D + +W A Sbjct: 81 YEGHSSGISDLAWSSDSHYTCSASDDCTLRIWDA 114 >At2g46280.3 68415.m05757 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 254 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEE 144 TYRGH+ + C VS D +R +GS D LW +E Sbjct: 47 TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSGKE 86 Score = 30.7 bits (66), Expect = 0.83 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAG-NKAFFDVDWSPLNNSIITASADRHVRLYDPRST 440 + S DH +W D G G N A + D S ++ +IT SAD+ +L+D +S Sbjct: 25 LFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSG 84 Query: 441 ESIVKTTFTSHT 476 + + F + T Sbjct: 85 KELFTFKFNAPT 96 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLW 123 GH K I L +AD + F +GS D LW Sbjct: 191 GHKKDITSLCKAADDSHFLTGSLDKTAKLW 220 >At2g46280.2 68415.m05756 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEE 144 TYRGH+ + C VS D +R +GS D LW +E Sbjct: 47 TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSGKE 86 Score = 30.7 bits (66), Expect = 0.83 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAG-NKAFFDVDWSPLNNSIITASADRHVRLYDPRST 440 + S DH +W D G G N A + D S ++ +IT SAD+ +L+D +S Sbjct: 25 LFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSG 84 Query: 441 ESIVKTTFTSHT 476 + + F + T Sbjct: 85 KELFTFKFNAPT 96 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLW 123 GH K I L +AD + F +GS D LW Sbjct: 191 GHKKDITSLCKAADDSHFLTGSLDKTAKLW 220 >At2g46280.1 68415.m05755 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEE 144 TYRGH+ + C VS D +R +GS D LW +E Sbjct: 47 TYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSGKE 86 Score = 30.7 bits (66), Expect = 0.83 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAG-NKAFFDVDWSPLNNSIITASADRHVRLYDPRST 440 + S DH +W D G G N A + D S ++ +IT SAD+ +L+D +S Sbjct: 25 LFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSG 84 Query: 441 ESIVKTTFTSHT 476 + + F + T Sbjct: 85 KELFTFKFNAPT 96 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLW 123 GH K I L +AD + F +GS D LW Sbjct: 191 GHKKDITSLCKAADDSHFLTGSLDKTAKLW 220 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYDPRST 440 V+S G D+++K+WD G + E ++ +D+ P + T SADR V+ +D + Sbjct: 158 VVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETF 217 Query: 441 ESI 449 E I Sbjct: 218 ELI 220 Score = 37.9 bits (84), Expect = 0.005 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS----LAEEENHPATKKSKPEH 183 C+ TY+GH +G+ L + DG SG DN V +W + L E ++H +S H Sbjct: 135 CIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH 194 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYDPRST 440 V+S G D+++K+WD G + E ++ +D+ P + T SADR V+ +D + Sbjct: 158 VVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETF 217 Query: 441 ESI 449 E I Sbjct: 218 ELI 220 Score = 37.9 bits (84), Expect = 0.005 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS----LAEEENHPATKKSKPEH 183 C+ TY+GH +G+ L + DG SG DN V +W + L E ++H +S H Sbjct: 135 CIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH 194 >At3g21060.1 68416.m02662 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Retinoblastoma-binding protein 5 (RBBP-5) [Homo sapiens](RBQ-3) Length = 547 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +3 Query: 297 IWDCDLGGIKQEIAGNK---AFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKT 458 IWD + GI +EI N A V WS + ++ ++AD+ + L+D + E I +T Sbjct: 49 IWDFETRGIAKEIRDNDCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIART 105 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 C+ TY+GH +G+ L + DG SG DN V +W Sbjct: 228 CIHTYKGHTRGVNVLRFTPDGRWIVSGGEDNVVKVW 263 >At2g46290.1 68415.m05758 eukaryotic translation initiation factor 3 subunit 2, putative / eIF-3 beta, putative / eIF3i, putative strong similarity to SP|Q38884 Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (eIF3i) (TGF-beta receptor interacting protein 1) (TRIP-1) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies)|19799885|gb|AU231175.1|AU231175 Length = 355 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEE 144 TYRGH + C +S D +R +GS D LW +E Sbjct: 74 TYRGHSGAVWCCDISRDSSRLITGSADQTAKLWDVKSGKE 113 Score = 28.7 bits (61), Expect = 3.3 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 1/120 (0%) Frame = +3 Query: 108 QCLSLECKLSRRRKPSSYEEK*TRTRHY*KSTDHFKRTQGGYLGCSMDGYNTVLSSGWDH 287 +C++ E + K SS++ TR R T +L + +G + + S DH Sbjct: 4 ECVNPEGLRFNQMKSSSHQTLETRMRPILMKGHERPLT---FLRYNRNG-DLLFSCAKDH 59 Query: 288 LLKIWDCDLGGIKQEIAGNK-AFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTF 464 +W D G G+ A + D S ++ +IT SAD+ +L+D +S + + F Sbjct: 60 TPTVWFADNGERLGTYRGHSGAVWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKF 119 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLW 123 GH + I L +AD + F +GS D LW Sbjct: 218 GHKEAITSLCKAADDSHFLTGSHDKTAKLW 247 >At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats Length = 910 Score = 36.3 bits (80), Expect = 0.017 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 2/110 (1%) Frame = +3 Query: 225 GGYLGCSMDGYNTVL-SSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITAS 401 G +G + D NT++ S+G+ LK+WD +K + + + + +N + T + Sbjct: 475 GEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQWDVGCSLVKIVYHRVNGLLATVA 534 Query: 402 ADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKT-KTLFSFLLDTTTR 548 D +RLYD + + + F HT + + +S+ K + S +D + R Sbjct: 535 DDFVIRLYDVVTLKMV--REFRGHTDRITDLCFSEDGKWVISSSMDGSLR 582 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEE 144 +RGH I L S DG S S D ++ +W LA++ Sbjct: 553 FRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQ 591 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 36.3 bits (80), Expect = 0.017 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 2/99 (2%) Frame = +3 Query: 270 SSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLYDPRSTES 446 ++ +DH ++ W+ + G + I + + ++ +P + + A+ + H+RL+D S Sbjct: 10 TASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITP-DKHYLAAACNPHIRLFDVNSNSP 68 Query: 447 IVKTTFTSHTGWVQSVRWS-KTKTLFSFLLDTTTRFKLW 560 T+ SHT V +V + K ++S D T K+W Sbjct: 69 QPVMTYDSHTNNVMAVGFQCDAKWMYSGSEDGTV--KIW 105 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 36.3 bits (80), Expect = 0.017 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 6/75 (8%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSASLA----EEENHPATKKSKPEHGTTRNP 201 GH + CL++S D N +GS D+ V LW A + P+T P + N Sbjct: 2666 GHCAPVTCLALSPDNNFLVTGSRDSTVLLWRIHKAFTSRTSVSEPSTGSGAPSSTSNTNL 2725 Query: 202 LTTL--KGHKEAISG 240 TL KG K + G Sbjct: 2726 ANTLANKGKKCRLEG 2740 >At5g43930.1 68418.m05374 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens] Length = 726 Score = 35.9 bits (79), Expect = 0.022 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAF-FDVDWSPLNNSII-TASADRHV 416 S DG T+ S+ DH +KI DC+ G + + G++ + V + P ++ I+ + S D V Sbjct: 115 STDG-RTLASTHGDHTVKIIDCETGNCLKVLTGHRRTPWVVRFHPHHSEIVASGSLDLEV 173 Query: 417 RLYDPRSTESI 449 RL++ ++E I Sbjct: 174 RLWNTTTSECI 184 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 35.9 bits (79), Expect = 0.022 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEEN 150 TYRGH + + L S G + ASG DN V +W S+A + Sbjct: 261 TYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNS 302 Score = 33.5 bits (73), Expect = 0.12 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 3/94 (3%) Frame = +3 Query: 231 YLGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNK---AFFDVDWSPLNNSIITAS 401 YL G VL+ DH + +WD G + + ++ ++W+P + Sbjct: 142 YLNLLDWGSANVLAIALDHTVYLWDASTGSTSELVTIDEEKGPVTSINWAPDGRHVAVGL 201 Query: 402 ADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWS 503 + V+L+D S + +T H V S+ W+ Sbjct: 202 NNSEVQLWDSASNRQL-RTLKGGHQSRVGSLAWN 234 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 35.9 bits (79), Expect = 0.022 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEEN 150 TYRGH + + L S G + ASG DN V +W S+A + Sbjct: 251 TYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNS 292 Score = 33.5 bits (73), Expect = 0.12 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 3/94 (3%) Frame = +3 Query: 231 YLGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNK---AFFDVDWSPLNNSIITAS 401 YL G VL+ DH + +WD G + + ++ ++W+P + Sbjct: 132 YLNLLDWGSANVLAIALDHTVYLWDASTGSTSELVTIDEEKGPVTSINWAPDGRHVAVGL 191 Query: 402 ADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWS 503 + V+L+D S + +T H V S+ W+ Sbjct: 192 NNSEVQLWDSASNRQL-RTLKGGHQSRVGSLAWN 224 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 35.9 bits (79), Expect = 0.022 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAF-FDVDWSPLNNSII-TASADRHV 416 S DG T+ S+ DH +KI DC+ G + + G++ + V + P ++ I+ + S D V Sbjct: 112 SSDG-RTLASTHGDHTVKIIDCETGKCLKILTGHRRTPWVVRFHPRHSEIVASGSLDHEV 170 Query: 417 RLYDPRSTESI 449 RL++ ++ E I Sbjct: 171 RLWNAKTGECI 181 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 35.9 bits (79), Expect = 0.022 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAF-FDVDWSPLNNSII-TASADRHV 416 S DG T+ S+ DH +KI DC+ G + + G++ + V + P ++ I+ + S D V Sbjct: 112 SSDG-RTLASTHGDHTVKIIDCETGKCLKILTGHRRTPWVVRFHPRHSEIVASGSLDHEV 170 Query: 417 RLYDPRSTESI 449 RL++ ++ E I Sbjct: 171 RLWNAKTGECI 181 >At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; WD-repeat protein, carrot, PIR:T14352 Length = 444 Score = 35.5 bits (78), Expect = 0.029 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEE 147 TY GH + + L S GN+ ASG DN V +W SLA + Sbjct: 247 TYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSK 287 >At3g49180.1 68416.m05375 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); GTP-binding protein beta chain homolog, Nicotiana tabacum, PIR:T16970 Length = 438 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +1 Query: 43 KGIECLSVSADGNRFASGSWDNNVCLW 123 K I CL+ ADGN SGS D VC+W Sbjct: 264 KAITCLAYCADGNLLISGSEDGVVCVW 290 Score = 32.3 bits (70), Expect = 0.27 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 + GH + + CL S D + SGS D ++ +WS Sbjct: 116 WHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWS 148 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 35.5 bits (78), Expect = 0.029 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDV-DWSPLNNS-IITASADRHVRLYDPR 434 ++S G D ++K WD + ++ G+K + D SP+N+S ++T S D V+++D R Sbjct: 151 LVSGGDDGVVKYWDVAGATVISDLLGHKDYVRCGDCSPVNDSMLVTGSYDHTVKVWDAR 209 Score = 27.9 bits (59), Expect = 5.8 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = +3 Query: 240 CSMDGYNTVLSSGWDHLLKIWDCDL--GGIKQEIAGNKAFFDVDWSPLNNSIITASADRH 413 CS + +++ +DH +K+WD + EI DV + P I TA + Sbjct: 186 CSPVNDSMLVTGSYDHTVKVWDARVHTSNWIAEINHGLPVEDVVYLPSGGLIATAGGN-S 244 Query: 414 VRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLL 533 V+++D +V + SH V S+R ++ ++ S L+ Sbjct: 245 VKVWDLIGGGKMV-CSMESHNKTVTSLRVARMESAESRLV 283 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 35.1 bits (77), Expect = 0.038 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 C + Y+GH + +S + G ASGS D +V +W Sbjct: 415 CYLEYKGHTGAVTSISTDSSGEWIASGSTDGSVRMW 450 >At4g34380.1 68417.m04884 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Myosin heavy chain kinase B (MHCK B).(SP:P90648) [Dictyostelium discoideum] Length = 495 Score = 34.3 bits (75), Expect = 0.067 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 +GH + CL ++ GN SGS D N+C+W Sbjct: 364 KGHKSAVLCLGIA--GNLLLSGSADKNICVW 392 >At1g52730.2 68414.m05959 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 34.3 bits (75), Expect = 0.067 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE-EENHPATKKSK 174 +GH + C+ + G +ASGS D + +W + A EEN ++++ K Sbjct: 267 KGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPANPEENETSSRRVK 315 >At1g52730.1 68414.m05958 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to UNR-interacting protein (WD-40 repeat protein PT-WD) (SP:Q9Y3F4) [Homo sapiens] Length = 343 Score = 34.3 bits (75), Expect = 0.067 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE-EENHPATKKSK 174 +GH + C+ + G +ASGS D + +W + A EEN ++++ K Sbjct: 267 KGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPANPEENETSSRRVK 315 >At1g24130.1 68414.m03044 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400);similar to beta transducin-like protein HET-D2Y (GI:17225210) [Podospora anserina]. Length = 415 Score = 34.3 bits (75), Expect = 0.067 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENH 153 RGH K I CL+V++D SGS D ++ +W L E+E + Sbjct: 325 RGHRKAIMCLAVASD--LVLSGSADKSLRVWRRGLMEKEGY 363 Score = 32.7 bits (71), Expect = 0.21 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 3/104 (2%) Frame = +3 Query: 234 LGCSMDGYNTVLSSGWDHLLKIW-DCDLGGIKQ-EIAGNKAFFDVDWSPLNNSIITASAD 407 L S DG + + S+ WD KIW D + E A + A + S + + T SAD Sbjct: 198 LALSQDG-SLLYSASWDRSFKIWRTSDFKCLDSIEKAHDDAINAIVVSK-DGFVYTGSAD 255 Query: 408 RHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKT-KTLFSFLLD 536 + +++++ + + + T T H V ++ S+ K L+S D Sbjct: 256 KKIKVWNKKDKKHSLVATLTKHLSAVNALAISEDGKVLYSGACD 299 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 T+ H + L++S DG+ S SWD + +W S Sbjct: 187 TWVHHVDAVSSLALSQDGSLLYSASWDRSFKIWRTS 222 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 33.9 bits (74), Expect = 0.089 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = +3 Query: 333 IAGNKAFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSV 494 IA A FD+ W ++ ++TAS D+ ++++D E+ HTG V+S+ Sbjct: 125 IAHYNAIFDISWIKGDSCLLTASGDQTIKVWDVE--ENKCTGVLIGHTGTVKSM 176 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLA 138 TY GH + + L S G + ASG DN V +W SLA Sbjct: 231 TYVGHTEEVCGLKWSESGKKLASGGNDNVVHIWDRSLA 268 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 ++T RGH + L+ S D + ASGS DN V +W+ Sbjct: 111 VMTLRGHTADVVDLNWSPDDSMLASGSLDNTVHIWN 146 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 33.5 bits (73), Expect = 0.12 Identities = 22/101 (21%), Positives = 39/101 (38%), Gaps = 1/101 (0%) Frame = +3 Query: 270 SSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASADRHVRLYDPRSTES 446 SSG+D L ++WD G+ K VD+SP + + D R++D R + Sbjct: 147 SSGFDSLARVWDLRTARNILIFQGHIKQVLSVDFSPNGYHLASGGEDNQCRIWDLRMRKL 206 Query: 447 IVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKLWGNQ 569 + +H V V++ + F +W + Sbjct: 207 LY--IIPAHVNLVSQVKYEPQERYFLATASHDMNVNIWSGR 245 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 ++ ++GH K + + S +G ASG DN +W Sbjct: 165 ILIFQGHIKQVLSVDFSPNGYHLASGGEDNQCRIW 199 >At5g64730.1 68418.m08140 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8) [Fruit fly] {Drosophila m.] Length = 299 Score = 33.1 bits (72), Expect = 0.16 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +3 Query: 249 DGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPL--NNSIITASADRHVRL 422 D + V+S+G+D L++WDC + + + F D S + II S D VR Sbjct: 112 DSSSVVVSAGFDRSLRVWDCRSHSV-EPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRT 170 Query: 423 YDPR 434 +D R Sbjct: 171 FDMR 174 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 33.1 bits (72), Expect = 0.16 Identities = 16/64 (25%), Positives = 27/64 (42%) Frame = +1 Query: 13 DCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTT 192 + +T GH I +S+S DG+ + DN +C+W +N +H Sbjct: 213 EATMTLEGHQDTITGMSLSPDGSYLLTNGMDNKLCVWDMRPYAPQNRCVKIFEGHQHNFE 272 Query: 193 RNPL 204 +N L Sbjct: 273 KNLL 276 Score = 32.3 bits (70), Expect = 0.27 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 9/104 (8%) Frame = +3 Query: 234 LGCSMDGYNTVLSSGWDHLLKIWD----CDLGGIKQEIAGNKAFFDVD-----WSPLNNS 386 + S DG + +L++G D+ L +WD + G++ F+ + WSP Sbjct: 228 MSLSPDG-SYLLTNGMDNKLCVWDMRPYAPQNRCVKIFEGHQHNFEKNLLKCSWSPDGTK 286 Query: 387 IITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTL 518 + S+DR V ++D S +I K HTG V + T+ + Sbjct: 287 VTAGSSDRMVHIWDTTSRRTIYK--LPGHTGSVNECVFHPTEPI 328 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/72 (29%), Positives = 27/72 (37%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTTL 213 GH + + + G ASGS D + LW HG +N L Sbjct: 51 GHPSAVYTMKFNPAGTLIASGSHDREIFLWRV-----------------HGDCKN-FMVL 92 Query: 214 KGHKEAISGVQW 249 KGHK AI + W Sbjct: 93 KGHKNAILDLHW 104 >At1g24530.1 68414.m03088 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 7 WD-40 repeats (PF00400) Length = 418 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +3 Query: 249 DGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITASADRHVRLY 425 DG+ + S WD LKIW K+ I + + N ++ T SADR +R++ Sbjct: 205 DGF--IYSVSWDKTLKIWRASDLRCKESIKAHDDAVNAIAVSTNGTVYTGSADRRIRVW 261 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 T H + L+++ DG+ SGS D ++ +W Sbjct: 275 TLEKHKSAVNALALNDDGSVLFSGSCDRSILVW 307 >At3g50390.1 68416.m05512 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to myosin heavy chain kinase B (gb:U90946) [Dictyostelium discoideum] Length = 469 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 1 RNSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 RN + +R H I CL++S D SGSWD +W S Sbjct: 199 RNRSSAALGFR-HLDAISCLALSEDKRLLYSGSWDKTFKVWRVS 241 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 32.7 bits (71), Expect = 0.21 Identities = 21/67 (31%), Positives = 35/67 (52%) Frame = +1 Query: 49 IECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTTLKGHKE 228 I C + +A+G F +GS D+N +WSAS ++ +P H L L+GH+ Sbjct: 452 ILCCAYNANGTIFVTGSSDSNARVWSASKPNLDD-----AEQPTH-----ELDVLRGHEN 501 Query: 229 AISGVQW 249 ++ VQ+ Sbjct: 502 DVNYVQF 508 >At2g25420.1 68415.m03045 transducin family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat (3 repeats) Length = 717 Score = 32.7 bits (71), Expect = 0.21 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 GHD+ I CL+ S N S D +CLWS Sbjct: 509 GHDQKITCLAFSRCFNVLVSSDSDGKLCLWS 539 >At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 receptor (PEX7) identical to peroxisomal targeting signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis thaliana]; WD-40 repeat protein family member; contains 6 WD-40 repeats (PF00400); similar to peroxismal targeting signal 2 receptor (PTS2R) (Peroxin-7) (PEX7)(SP:O00628) [Homo sapiens] Length = 317 Score = 32.7 bits (71), Expect = 0.21 Identities = 22/103 (21%), Positives = 42/103 (40%), Gaps = 2/103 (1%) Frame = +3 Query: 258 NTVLSSGWDHLLKIWDCDL-GGIKQEIAGNKAFFDVDWSPLNNSII-TASADRHVRLYDP 431 ++ L+S WD +K+W D ++ + W+P + + +AS D +R++D Sbjct: 120 DSFLTSSWDDTVKLWAMDRPASVRTFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDV 179 Query: 432 RSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKLW 560 R S + +H + S W+K K+W Sbjct: 180 REPGSTM--IIPAHDFEILSCDWNKYDDCILATSSVDKTVKVW 220 >At5g64630.3 68418.m08123 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 428 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLY 425 ++S D+ IWD + G + Q + + + V W PL + + S+DR R+Y Sbjct: 68 LISGSVDNSCIIWDVNKGSVHQILDAHCHYVQGVAWDPLAKYVASLSSDRTCRIY 122 >At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 487 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLY 425 ++S D+ IWD + G + Q + + + V W PL + + S+DR R+Y Sbjct: 127 LISGSVDNSCIIWDVNKGSVHQILDAHCHYVQGVAWDPLAKYVASLSSDRTCRIY 181 >At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 397 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFD-VDWSPLNNSIITASADRHVRLY 425 ++S D+ IWD + G + Q + + + V W PL + + S+DR R+Y Sbjct: 127 LISGSVDNSCIIWDVNKGSVHQILDAHCHYVQGVAWDPLAKYVASLSSDRTCRIY 181 >At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GI:17225206) [Podospora anserina] Length = 315 Score = 32.3 bits (70), Expect = 0.27 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 7/66 (10%) Frame = +3 Query: 261 TVLSSGW-DHLLKIWDCDLGGIKQ----EIAGNKAFFD-VDWSPLNNSII-TASADRHVR 419 T L+SG D +IW+ + G + E+ G+ D + W P ++ ++ TAS D+ VR Sbjct: 33 TKLASGSVDQTARIWNIEPHGHSKAKDLELKGHTDSVDQLCWDPKHSDLVATASGDKSVR 92 Query: 420 LYDPRS 437 L+D RS Sbjct: 93 LWDARS 98 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 T H G C+++ G FA GS D+ V LW S Sbjct: 186 TLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDIS 221 Score = 31.5 bits (68), Expect = 0.47 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLT 207 Y+GH K + ++ +++G + ASGS D +W+ HG ++ Sbjct: 16 YQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIE---------------PHGHSKAKDL 60 Query: 208 TLKGHKEAISGVQW 249 LKGH +++ + W Sbjct: 61 ELKGHTDSVDQLCW 74 >At2g33340.2 68415.m04087 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 537 Score = 32.3 bits (70), Expect = 0.27 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 6/110 (5%) Frame = +3 Query: 240 CSMD---GYNTVLSSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASAD 407 CSMD + + + G D ++D G I + G+ K V + ++ ++TASAD Sbjct: 226 CSMDILHSKDVIATGGVDATAVLFDRPSGQILSTLTGHSKKVTSVKFVGDSDLVLTASAD 285 Query: 408 RHVRLY-DPRSTESIVKTTFTSHTGWVQSVRWSKTKTLF-SFLLDTTTRF 551 + VR++ +P T H+ V++V T F S LD T F Sbjct: 286 KTVRIWRNPGDGNYACGYTLNDHSAEVRAVTVHPTNKYFVSASLDGTWCF 335 >At2g33340.1 68415.m04086 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to cell cycle control protein cwf8 (SP:O14011) [Schizosaccharomyces pombe (Fission yeast)] Length = 565 Score = 32.3 bits (70), Expect = 0.27 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 6/110 (5%) Frame = +3 Query: 240 CSMD---GYNTVLSSGWDHLLKIWDCDLGGIKQEIAGN-KAFFDVDWSPLNNSIITASAD 407 CSMD + + + G D ++D G I + G+ K V + ++ ++TASAD Sbjct: 226 CSMDILHSKDVIATGGVDATAVLFDRPSGQILSTLTGHSKKVTSVKFVGDSDLVLTASAD 285 Query: 408 RHVRLY-DPRSTESIVKTTFTSHTGWVQSVRWSKTKTLF-SFLLDTTTRF 551 + VR++ +P T H+ V++V T F S LD T F Sbjct: 286 KTVRIWRNPGDGNYACGYTLNDHSAEVRAVTVHPTNKYFVSASLDGTWCF 335 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 32.3 bits (70), Expect = 0.27 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 3/58 (5%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEI-AGNKAF-FDVDWSPLN-NSIITASADRHVRLYD 428 VLSS D L+K+WD + G + +I G+ + V ++P + N+ +AS DR +++++ Sbjct: 114 VLSSSDDMLIKLWDWEKGWLCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWN 171 >At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-related contains Pfam PF00400: WD domain, G-beta repeat; similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 1280 Score = 32.3 bits (70), Expect = 0.27 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 R H + C++V+AD A+GS+D V +W Sbjct: 1043 RHHKDVVSCVAVTADSTILATGSYDTTVMVW 1073 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSK 174 N+ +C+ TY H+ + L+V A+G D + LW S A ++ K+ + Sbjct: 613 NTSECIATYDQHEDKVWALAVGKKTEMIATGGGDAVINLWHDSTASDKEDDFRKEEE 669 Score = 30.7 bits (66), Expect = 0.83 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 C+ T+ GH + S DG +F S D + LW+ + +E Sbjct: 575 CLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTSE 616 Score = 29.1 bits (62), Expect = 2.5 Identities = 22/81 (27%), Positives = 34/81 (41%) Frame = +3 Query: 378 NNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKL 557 N I+T S D+ VRL++ S I T H G + +V ++K F K+ Sbjct: 416 NVLIVTGSKDKTVRLWNATSKSCI--GVGTGHNGDILAVAFAKKSFSFFVSGSGDRTLKV 473 Query: 558 WGNQGSPRNSTFMTLKRTRRI 620 W G +S +TR + Sbjct: 474 WSLDGISEDSEEPINLKTRSV 494 Score = 24.6 bits (51), Expect(2) = 4.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLW 123 HDK I ++V+ + + +GS D +W Sbjct: 498 HDKDINSVAVARNDSLVCTGSEDRTASIW 526 Score = 21.8 bits (44), Expect(2) = 4.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 202 LTTLKGHKEAISGVQWMDTTQ 264 + TLKGHK I V++ Q Sbjct: 534 VVTLKGHKRRIFSVEFSTVDQ 554 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 31.9 bits (69), Expect = 0.36 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLW 123 HDK + C+ S + +GSWD V W Sbjct: 97 HDKAVRCVEYSYAAGQVITGSWDKTVKCW 125 Score = 30.7 bits (66), Expect = 0.83 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 5/99 (5%) Frame = +3 Query: 177 RTRHY*KSTDHFKRT---QGGYLGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAG-- 341 R R Y ST+ K G L C + S G D+ ++ ++G K++I G Sbjct: 40 RVRLYDVSTNSLKGEFLHGGAVLDCCFHDDFSGFSVGADYKVRRIVFNVG--KEDILGTH 97 Query: 342 NKAFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKT 458 +KA V++S +IT S D+ V+ +DPR +T Sbjct: 98 DKAVRCVEYSYAAGQVITGSWDKTVKCWDPRGASGPERT 136 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +3 Query: 264 VLSSGWDHLLKIWDC-DLGGIKQEIAGNKAFFD--VDWSPLNNSIITASADRHVRLYDPR 434 V++ WD +K WD G ++ G + S + + ++ A+A RHV +YD R Sbjct: 113 VITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLR 172 Query: 435 S 437 + Sbjct: 173 N 173 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 31.9 bits (69), Expect = 0.36 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +3 Query: 297 IWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSH 473 +W G IK ++G++A + +SPL + ++S D VRL+D +++ V+T +H Sbjct: 461 VWSKKTGQIKDILSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWDVFASKGTVETFRHNH 520 Query: 474 TGWVQSVRWSKTKTLFSFLLDTTTRF 551 + R K L S LD F Sbjct: 521 DVLTVAFR-PDGKQLASSTLDGQINF 545 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 ++ +GH + C++ S D A+G+ DN V +W+ Sbjct: 342 ILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVWN 377 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 31.9 bits (69), Expect = 0.36 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = +3 Query: 297 IWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSH 473 +W G IK ++G++A + +SPL + ++S D VRL+D +++ V+T +H Sbjct: 501 VWSKKTGQIKDILSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWDVFASKGTVETFRHNH 560 Query: 474 TGWVQSVRWSKTKTLFSFLLDTTTRF 551 + R K L S LD F Sbjct: 561 DVLTVAFR-PDGKQLASSTLDGQINF 585 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 ++ +GH + C++ S D A+G+ DN V +W+ Sbjct: 382 ILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVWN 417 >At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; similar to "Will die slowly" protein, Drosophia; putative cdc20 protein - Arabidopsis thaliana, EMBL:AF029262 Length = 411 Score = 31.5 bits (68), Expect = 0.47 Identities = 23/75 (30%), Positives = 32/75 (42%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPL 204 TY GH + + L S G + ASG DN V +W +H + S P TR L Sbjct: 213 TYLGHTEEVCGLKWSESGKKLASGGNDNVVHIW--------DHRSVASSNP----TRQWL 260 Query: 205 TTLKGHKEAISGVQW 249 + H A+ + W Sbjct: 261 HRFEEHTAAVRALAW 275 >At4g29830.1 68417.m04246 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); G protein beta subunit-like protein, Schistosoma mansoni, gb:U30261 Length = 321 Score = 31.5 bits (68), Expect = 0.47 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 2/79 (2%) Frame = +3 Query: 264 VLSSGWDH-LLKIWDCDLGGIKQEIAGNKAF-FDVDWSPLNNSIITASADRHVRLYDPRS 437 VL SG D + + D + + ++G+ ++ VD SP +I T S+DR VRL+D + Sbjct: 215 VLFSGSDDGHVNMHDAEGKTLLGSMSGHTSWVLSVDASPDGGAIATGSSDRTVRLWDLKM 274 Query: 438 TESIVKTTFTSHTGWVQSV 494 +I T ++H V SV Sbjct: 275 RAAI--QTMSNHNDQVWSV 291 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSASL 135 GH + + S DG A+GS D V LW + Sbjct: 241 GHTSWVLSVDASPDGGAIATGSSDRTVRLWDLKM 274 >At4g00090.1 68417.m00009 transducin family protein / WD-40 repeat family protein similar to Transducin beta-like 2 protein (WS beta-transducin repeats protein) (WS-betaTRP) (Williams-Beuren syndrome chromosome region 13 protein) (SP:Q9Y4P3) {Homo sapiens} Length = 430 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 136 AEEENHPATKKSKPEHGTTRNPL--TTLKGHKEAISGV 243 A ++NHP ++ S +PL TLKGH +A++G+ Sbjct: 55 APKKNHPKSQASDKNQNKRHHPLDLNTLKGHGDAVTGL 92 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 31.5 bits (68), Expect = 0.47 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 240 CSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEI-AGNKAFFDVDWSPLNNSIITASA-DRH 413 C D + +L+ D+ WD + I E+ AGN FDV W P +I+AS+ D Sbjct: 272 CPSDS-SYLLTCAKDNRTICWDTNTAEIVAELPAGNNWNFDVHWYPKIPGVISASSFDGK 330 Query: 414 VRLYD 428 + +Y+ Sbjct: 331 IGIYN 335 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENH-PATKKS 171 ++G +G+E ++S+ N ASG+ D +C+W E +H P K S Sbjct: 121 HKGPVRGLEFNAISS--NLLASGADDGEICIWDLLKPSEPSHFPLLKGS 167 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 31.5 bits (68), Expect = 0.47 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 240 CSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEI-AGNKAFFDVDWSPLNNSIITASA-DRH 413 C D + +L+ D+ WD + I E+ AGN FDV W P +I+AS+ D Sbjct: 272 CPSDS-SYLLTCAKDNRTICWDTNTAEIVAELPAGNNWNFDVHWYPKIPGVISASSFDGK 330 Query: 414 VRLYD 428 + +Y+ Sbjct: 331 IGIYN 335 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENH-PATKKS 171 ++G +G+E ++S+ N ASG+ D +C+W E +H P K S Sbjct: 121 HKGPVRGLEFNAISS--NLLASGADDGEICIWDLLKPSEPSHFPLLKGS 167 >At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 473 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 T RGH + CL+ A G+ SG D N+C+W Sbjct: 376 TLRGHRLAVLCLA--AAGSLVLSGGADKNICVW 406 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 H + CLS++ + SGSWD + +W S Sbjct: 248 HYDAVSCLSLNEELGLLYSGSWDKTLKVWRLS 279 >At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1135 Score = 31.5 bits (68), Expect = 0.47 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPL-- 204 +GH K + L+ S N S D+ +C+WS E++ A+K+ + G + NPL Sbjct: 926 KGHQKRVTGLAFSNVLNVLVSSGADSQLCVWSMDGWEKQ---ASKQIQIPSGHSPNPLAH 982 Query: 205 TTLKGHKEAI 234 T ++ H++ I Sbjct: 983 TRVQFHQDQI 992 >At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1137 Score = 31.5 bits (68), Expect = 0.47 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPL-- 204 +GH K + L+ S N S D+ +C+WS E++ A+K+ + G + NPL Sbjct: 926 KGHQKRVTGLAFSNVLNVLVSSGADSQLCVWSMDGWEKQ---ASKQIQIPSGHSPNPLAH 982 Query: 205 TTLKGHKEAI 234 T ++ H++ I Sbjct: 983 TRVQFHQDQI 992 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 31.5 bits (68), Expect = 0.47 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLG-GIKQEIAGNKAF-FDVDWSPLN-NSIITASADRHVRLYD 428 VLSS D L+K+WD + G Q G+ + V ++P + N+ +AS DR +++++ Sbjct: 114 VLSSSDDMLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWN 171 >At5g66240.2 68418.m08345 transducin family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak); similar to Will die slowly protein. {Drosophila melanogaster} (SP:Q9V3J8) {Drosophila melanogaster} Length = 331 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 ++GH + LS+ + G F SGS D V LW Sbjct: 116 FKGHHDRVVSLSLCSGGECFISGSLDRTVLLW 147 >At5g66240.1 68418.m08344 transducin family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak); similar to Will die slowly protein. {Drosophila melanogaster} (SP:Q9V3J8) {Drosophila melanogaster} Length = 328 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 ++GH + LS+ + G F SGS D V LW Sbjct: 113 FKGHHDRVVSLSLCSGGECFISGSLDRTVLLW 144 >At5g60940.2 68418.m07645 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 337 Score = 31.1 bits (67), Expect = 0.63 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 5/101 (4%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNS----IITASADRHVRLYDP 431 VLSSG D +K+W+ G + +E G K + N++ I A V +D Sbjct: 233 VLSSGKDSTVKLWEIGSGRMVKEYLGAKRVKLRSQAIFNDTEEFVISIDEASNEVVTWDA 292 Query: 432 RSTESIVKTTFTSHTGWVQSVRWSKTKTLF-SFLLDTTTRF 551 R+ + + K ++H G + + S +++F + +D + RF Sbjct: 293 RTADKVAKWP-SNHNGAPRWIEHSPVESVFVTCGIDRSIRF 332 >At5g60940.1 68418.m07644 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 429 Score = 31.1 bits (67), Expect = 0.63 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 5/101 (4%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNS----IITASADRHVRLYDP 431 VLSSG D +K+W+ G + +E G K + N++ I A V +D Sbjct: 325 VLSSGKDSTVKLWEIGSGRMVKEYLGAKRVKLRSQAIFNDTEEFVISIDEASNEVVTWDA 384 Query: 432 RSTESIVKTTFTSHTGWVQSVRWSKTKTLF-SFLLDTTTRF 551 R+ + + K ++H G + + S +++F + +D + RF Sbjct: 385 RTADKVAKWP-SNHNGAPRWIEHSPVESVFVTCGIDRSIRF 424 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 306 CDLGGIKQEIAGNK-AFFDVDWSPLNNSIITASADRHVRLYD 428 C++ G G+K + + V WSP ++T SAD+ +++D Sbjct: 219 CEILGELSSDDGHKGSIYAVSWSPDGKQVLTVSADKSAKIWD 260 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 31.1 bits (67), Expect = 0.63 Identities = 20/61 (32%), Positives = 28/61 (45%) Frame = +3 Query: 378 NNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKL 557 +N I SAD H+ YD R+ + F+ H V V++ L S D+T R L Sbjct: 518 SNYIAVGSADHHIHYYDLRNISQPLH-VFSGHKKAVSYVKFLSNNELASASTDSTLR--L 574 Query: 558 W 560 W Sbjct: 575 W 575 >At2g28290.2 68415.m03434 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3529 Score = 31.1 bits (67), Expect = 0.63 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 216 RTQGGYLGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSP 374 +T GG G +DG+N S + LL I +G + + A FD DW+P Sbjct: 1122 QTSGGDRGALIDGFNKSGSPFFIFLLSIRAGGVG-VNLQAADTVILFDTDWNP 1173 >At2g28290.1 68415.m03433 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3574 Score = 31.1 bits (67), Expect = 0.63 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 216 RTQGGYLGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSP 374 +T GG G +DG+N S + LL I +G + + A FD DW+P Sbjct: 1122 QTSGGDRGALIDGFNKSGSPFFIFLLSIRAGGVG-VNLQAADTVILFDTDWNP 1173 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 13 DCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 +C+ T GH+ ++ +S +A G+ A+ S D +V +W Sbjct: 109 ECISTLEGHENEVKSVSWNASGSCLATCSRDKSVWIW 145 Score = 29.9 bits (64), Expect = 1.4 Identities = 23/87 (26%), Positives = 34/87 (39%) Frame = +3 Query: 243 SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITASADRHVRL 422 S G NTV L + W C + +E + WSP + TAS D + Sbjct: 44 SCSGDNTVRIWEQSSLSRSWTCKT--VLEE-THTRTVRSCAWSPSGQLLATASFDGTTGI 100 Query: 423 YDPRSTESIVKTTFTSHTGWVQSVRWS 503 + +E +T H V+SV W+ Sbjct: 101 WKNYGSEFECISTLEGHENEVKSVSWN 127 >At1g71840.1 68414.m08302 transducin family protein / WD-40 repeat family protein contains Pfam profile:PF00560 Leucine Rich Repeat (4 copies); Pfam profile:PF00069 Eukaryotic protein kinase domain; Pfam profile:PF00400 WD domain, G-beta repeat (7 copies) Length = 407 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 GH + CL+ S DG ASG D V ++ AS Sbjct: 111 GHKDSVSCLAFSYDGQLLASGGLDGVVQIFDAS 143 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 13 DCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 +C+ TY GH ++ +SVS + + S S DN ++ +S Sbjct: 361 NCVHTYHGHQDAVQAISVSTNTDFIVSVSVDNTARVFESS 400 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 + GH+ + C + DG +GS D ++ +W+ E Sbjct: 193 FSGHNLNVTCGDFTPDGKLICTGSDDASLIVWNPKTCE 230 >At3g15610.1 68416.m01980 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to serine/threonine kinase receptor associated protein GB:NP_035629 (SP:Q9Z1Z2) [Mus musculus]; UNR-interacting protein GB:NP_009109 [Homo sapiens] Length = 341 Score = 30.7 bits (66), Expect = 0.83 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPE 180 +GH + C+ + G +ASGS D + +W E +SKP+ Sbjct: 267 KGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEE---ISESKPK 313 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 30.7 bits (66), Expect = 0.83 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEEN 150 GH+ + L ++AD + A+ S D + LW++S ++E+ Sbjct: 506 GHESKVASLDITADSSCIATVSHDRTIKLWTSSGNDDED 544 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +3 Query: 357 DVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKT-KTLFSFLL 533 DV +SP+++ + TASADR +L+ T+ + TF H + V + + K L + Sbjct: 303 DVVFSPVDDCLATASADRTAKLW---KTDGTLLQTFEGHLDRLARVAFHPSGKYLGTTSY 359 Query: 534 DTTTRFKLW 560 D T ++LW Sbjct: 360 DKT--WRLW 366 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 ++ ++GH K + ++ S +G ASG DN +W Sbjct: 416 ILVFQGHIKPVFSVNFSPNGYHLASGGEDNQCRIW 450 >At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI2 (SP:O22468) [Arabidopsis thaliana] WD-40 repeats (PF0400); Length = 415 Score = 30.7 bits (66), Expect = 0.83 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +1 Query: 34 GHDKGIECLSVSADGNRFA-SGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTT 210 GHDK LS S + SGS D +CLW S AT + K N + Sbjct: 166 GHDKEGYGLSWSPFKEGYLLSGSQDQKICLWDVS--------ATPQDK-----VLNAMFV 212 Query: 211 LKGHKEAISGVQW 249 +GH+ AI+ V W Sbjct: 213 YEGHESAIADVSW 225 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 30.7 bits (66), Expect = 0.83 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +3 Query: 366 WSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTT 545 WSP N + T S D V +Y+ S T +H G V +V + T+ S D + Sbjct: 407 WSPNNKMVATGSIDTCVIVYEVDKPASSRITARNAHLGGVNAVAFIDDCTVASSGEDASV 466 Query: 546 RFKLW 560 R LW Sbjct: 467 R--LW 469 Score = 29.5 bits (63), Expect = 1.9 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 10/103 (9%) Frame = +3 Query: 216 RTQGGYLGC---SMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIA---GNK-AFFDVDWSP 374 R ++ C S DG + S D I+D G E+A G+K + + V WSP Sbjct: 48 REHSNFVNCIRYSPDGTKFITVSS-DKKGMIYDGKTGDKVGELASEDGHKGSIYAVSWSP 106 Query: 375 LNNSIITASADRHVRLY---DPRSTESIVKTTFTSHTGWVQSV 494 + ++T SAD+ +++ + + S++KT +G + + Sbjct: 107 DSKRVLTVSADKSAKVWEVAEDGTIGSVIKTLSFMESGGAEDM 149 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 30.7 bits (66), Expect = 0.83 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +3 Query: 264 VLSSGWDHLLKIWDC-DLGGIKQEIAGNKAFFDV--DWSPLNNSIITASADRHVRLYDPR 434 V++ WD +K WD G ++ G + S + N ++ A+A RHV +YD R Sbjct: 112 VITGSWDKTIKCWDPRGASGTERTQIGTYMQPERVNSLSLVGNRLVVATAGRHVNIYDLR 171 Query: 435 S 437 + Sbjct: 172 N 172 Score = 29.1 bits (62), Expect = 2.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLW 123 H+K + C+ S + +GSWD + W Sbjct: 96 HEKPVRCVEYSYAAGQVITGSWDKTIKCW 124 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +3 Query: 294 KIWDCDLGGIKQEIAGN--KAFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKT 458 K+ D K+++ G K V++S +IT S D+ ++ +DPR +T Sbjct: 79 KVRRIDFNAGKEDVLGTHEKPVRCVEYSYAAGQVITGSWDKTIKCWDPRGASGTERT 135 >At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 471 Score = 30.7 bits (66), Expect = 0.83 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 H + CLS++ D SGSWD + +W S Sbjct: 244 HFDAVSCLSLNEDLGLLYSGSWDKTLKVWRLS 275 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 T GH + CL+ + G+ SG D N+C+W Sbjct: 372 TIHGHRMAVLCLATA--GSLLLSGGADKNICVW 402 >At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein (GI:2739374) [Arabidopsis thaliana] Length = 351 Score = 30.7 bits (66), Expect = 0.83 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLW 123 H + CLS++ D S SWD V +W Sbjct: 134 HSDAVSCLSLAEDQGLLYSASWDRTVKVW 162 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 30.7 bits (66), Expect = 0.83 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 5/100 (5%) Frame = +3 Query: 267 LSSGWDHLLKIWDCDLGG--IKQEIAGNKAFFDVDWSPLNNSIITA-SADRHVRLYDPRS 437 ++ +DH LK+WD + + ++ G + +++++I A + D VRL D S Sbjct: 120 ITGSFDHYLKVWDTNTAQAVVDFKMPGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIAS 179 Query: 438 TESIVKTTFTSHTGWVQSVRWSKTK--TLFSFLLDTTTRF 551 T + H V SV WS + L++ D RF Sbjct: 180 --GAFSHTLSGHRDGVMSVEWSTSSEWVLYTGGCDGAIRF 217 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 462 FTSHTGWVQSVRWSKTKTLFSFLLDTTTRFKLW 560 F HTG V + WSK L S +D T R LW Sbjct: 324 FRGHTGEVLDISWSKDNYLLSASMDKTVR--LW 354 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = +3 Query: 210 FKRTQGGYLGCSMDGYNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLN-NS 386 F+ G L S N +LS+ D +++W A N V ++P+N N Sbjct: 324 FRGHTGEVLDISWSKDNYLLSASMDKTVRLWKVGSNDCLGVFAHNSYVTSVQFNPVNENY 383 Query: 387 IITASADRHVRLYD 428 ++ S D VR+++ Sbjct: 384 FMSGSIDGKVRIWN 397 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 30.3 bits (65), Expect = 1.1 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 7/69 (10%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVS---ADGNRFASGSWDNNVCLWSAS----LAEEENHPAT 162 +S + TY GH C+S + +G R SGS DN V +W + L + E H T Sbjct: 228 SSAKFLKTYTGHVNAQYCISSAFSVTNGKRIVSGSEDNCVHMWELNSKKLLQKLEGHTET 287 Query: 163 KKSKPEHGT 189 + H T Sbjct: 288 VMNVACHPT 296 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 T GH C++ + N SGS+D V +W + Sbjct: 108 TLIGHTNYAFCVNFNPQSNMIVSGSFDETVRIWDVT 143 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLG-GIKQEIAGNKAF-FDVDWSPLN-NSIITASADRHVRLYD 428 VLSS D L+K+WD + G Q G+ + V ++P + N+ +AS DR +++++ Sbjct: 114 VLSSSDDMLIKLWDWENGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWN 171 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLG-GIKQEIAGNKAF-FDVDWSPLN-NSIITASADRHVRLYD 428 VLSS D L+K+WD + G Q G+ + V ++P + N+ +AS DR +++++ Sbjct: 114 VLSSSDDMLIKLWDWENGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWN 171 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLG-GIKQEIAGNKAF-FDVDWSPLN-NSIITASADRHVRLYD 428 VLSS D L+K+WD + G Q G+ + V ++P + N+ +AS DR +++++ Sbjct: 114 VLSSSDDMLIKLWDWENGWACTQIFEGHSHYVMQVVFNPKDTNTFASASLDRTIKIWN 171 >At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat family protein similar to Cockayne syndrome complementaion group A proteins (GI:18077663)[Mus musculus] and (SP:Q13216)[Homo sapiens]; confirmed by full-length cDNA GI:15982896 Length = 450 Score = 30.3 bits (65), Expect = 1.1 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 5/100 (5%) Frame = +3 Query: 267 LSSGWDHLLKIWDCDLGGIKQE--IAGNKAFFDVDWSPLNNSIITASADR-HVRLYDPRS 437 ++ +DH +K+WD + + + + G + +++++I A D VRL D S Sbjct: 120 ITGSFDHYVKVWDTNTSQVVVDFKMPGKVYRTAMSSMAMSHTLIAAGTDDVQVRLCDIAS 179 Query: 438 TESIVKTTFTSHTGWVQSVRWSKTK--TLFSFLLDTTTRF 551 T + H V SV WS + L++ D RF Sbjct: 180 --GAFSHTLSGHRDGVMSVEWSTSSEWVLYTGGCDGAIRF 217 >At5g27080.1 68418.m03231 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; Length = 466 Score = 29.9 bits (64), Expect = 1.4 Identities = 23/75 (30%), Positives = 32/75 (42%) Frame = +1 Query: 25 TYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPL 204 TY GH + + L S G + ASG N V +W +H + SKP TR L Sbjct: 244 TYLGHTEEVCGLKWSESGKKLASGGNYNVVHIW--------DHRSVASSKP----TRQWL 291 Query: 205 TTLKGHKEAISGVQW 249 + H A+ + W Sbjct: 292 HRFEEHTAAVRALAW 306 >At4g34460.3 68417.m04900 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 347 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 16 CMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENH 153 C T +GH + L + + NR S S D + +W+A L ++ H Sbjct: 57 CCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNA-LTSQKTH 101 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAE 141 Y H+K L+VS+DG A+G D +V LW E Sbjct: 202 YTRHNKQSLALAVSSDGRYLATGGVDCHVHLWDIRTRE 239 >At2g46560.1 68415.m05808 transducin family protein / WD-40 repeat family protein similar to CPY (GI:3096961) {Chironomus thummi}; contains Pfam PF00400: WD domain, G-beta repeat (8 copies, 3 weak)|9780477|gb|BE522499.1|BE522499 Length = 2471 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 76 GNRFASGSWDNNVCLWSASLAEEEN-HP 156 G+RFAS + D VC W + + N HP Sbjct: 2218 GHRFASAALDGTVCTWQSEVGGRSNIHP 2245 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLW 123 HD + C+ S D ASGS D + +W Sbjct: 262 HDDPVLCIDFSRDSEMLASGSQDGKIKIW 290 >At1g18830.1 68414.m02345 transducin family protein / WD-40 repeat family protein similar to Sec31p (GI:13928450) {Oryza sativa} Length = 969 Score = 29.9 bits (64), Expect = 1.4 Identities = 30/104 (28%), Positives = 48/104 (46%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLT 207 ++G +G+E +V + N+ ASG+ D VC+W + SKP H Sbjct: 114 HKGPVRGLE-FNVKSP-NQLASGADDGTVCIWDLA----------NPSKPSHYLK----G 157 Query: 208 TLKGHKEAISGVQWMDTTQYCPVVGTTY*KFGTVIWVVLNKKLL 339 T + IS + W Q+ V+ +T TVIW V N+K++ Sbjct: 158 TGSYMQSEISSLSWNKGFQH--VLASTSHNGTTVIWDVNNEKII 199 Score = 29.5 bits (63), Expect = 1.9 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEI-AGNKAFFDVDWSPLNNSIITASA-DRHVRLYD 428 +L+ G D+ W+ G I E+ G FDV W P +I+AS+ D + +Y+ Sbjct: 268 LLTCGKDNRTICWNTKTGKIVAELPTGQNWNFDVHWYPKMPGVISASSVDGKIGIYN 324 >At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-related similar to BEIGE (GI:3928547) [Rattus norvegicus]; Similar to gb|U70015 lysosomal trafficking regulator from Mus musculus and contains 2 Pfam PF00400 WD-40, G-beta repeats. ESTs gb|T43386 and gb|AA395236 come from this gene Length = 3601 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 49 IECLSVSADGNRFASGSWDNNVCLWSAS 132 I+C VS DG +G+ D VC+W S Sbjct: 3333 IQCAGVSHDGRIVVTGAEDGLVCVWRVS 3360 >At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat family protein Similar to En/Spm-like transposon protein (gi:2739374)[Arabidopsis thaliana]; similar to GTP-binding regulatory protein and WD-repeat protein; contains 7 WD-40 repeats Length = 388 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 RGH + + CL+V +D SGS D V LW S Sbjct: 302 RGHTESVLCLAVVSD--ILCSGSADKTVRLWKCS 333 Score = 27.9 bits (59), Expect = 5.8 Identities = 25/92 (27%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +3 Query: 183 RHY*KSTDHFKRTQGGYLGCSMDGYNTVLSSGWDHLLKIW-DCDLGGIKQEIAGNKAFFD 359 RH S H G L S DG + S WD LKIW D ++ + + Sbjct: 155 RHKKASWVHHVDAVSG-LALSRDG-TLLYSVSWDRTLKIWRTTDFKCLESFTNAHDDAIN 212 Query: 360 VDWSPLNNSIITASADRHVRLYDPRSTESIVK 455 N I T S+D+ ++++ E VK Sbjct: 213 AVALSENGDIYTGSSDQRIKVWRKNINEENVK 244 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/80 (23%), Positives = 35/80 (43%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITASADRHVRLYDPRSTE 443 V++ D L+K+W D G++ D + +N+I ASA + R + Sbjct: 260 VITGSDDRLVKVWSMDTAYCLASCRGHEGDI-TDLAVSSNNIFIASASNDCVIRVWRLPD 318 Query: 444 SIVKTTFTSHTGWVQSVRWS 503 + + HTG V ++ +S Sbjct: 319 GLPVSVLRGHTGAVTAIAFS 338 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 29.5 bits (63), Expect = 1.9 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATK--KSKPEHGTTR 195 +GH K I L+ S N S D +C WS E+ A + K +G TR Sbjct: 901 KGHQKRITGLAFSTALNILVSSGADAQICFWSIDTWEKRKSVAIQMPAGKAANGDTR 957 >At4g35810.1 68417.m05088 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715], Homo sapiens [GI:18073925]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 290 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -2 Query: 602 KGHKSGVPWTSLVSPKFKPGCRIQQKRKECLCF---RPAN*LDPS 477 KG+ S VPW +S K G + K+++ L F +P LDPS Sbjct: 220 KGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPS 264 >At4g28450.1 68417.m04071 transducin family protein / WD-40 repeat family protein SOF1 (involved in rRNA processing) protein-yeast Length = 442 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 348 AFFDVDWSPLNNSIITASADRHVRLY 425 A D+D+SP +T S DR VR++ Sbjct: 281 AVMDIDFSPTGREFVTGSYDRSVRIF 306 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 55 CLSVSADGNRFASGSWDNNVCLWSASLAEE 144 C+ S D SGS D N+ LW A +E+ Sbjct: 327 CVKYSCDATYVISGSDDTNLRLWKAKASEQ 356 >At3g12150.1 68416.m01514 expressed protein Length = 363 Score = 29.5 bits (63), Expect = 1.9 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 3/88 (3%) Frame = -2 Query: 260 VVSIH*TPEIASLCPFKVVSGFLVVPCSGLLFFVAGWFSSSAKLALQRQTL-LSQLPLAK 84 V S+H TP +A+L PF +V C G+L + W + +LA Q+ T+ L ++ Sbjct: 222 VGSLHPTP-VATL-PFLSPHSAVVAFCEGILKYGTAWEALREELAAQKITMTLDEVRERM 279 Query: 83 R--LPSADTDRHSIPLS*PR*VIIQSTE 6 R L D R IP + + + +T+ Sbjct: 280 RNVLSLTDVTRFPIPKNPDAVIFVAATD 307 >At2g16405.1 68415.m01878 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD-repeat protein 13 (SP:Q9H1Z4) [Homo sapiens] Length = 482 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITA-SADRHVRLYDPRST 440 + SS D +++W+ G + I G + + + P+NN+ ++A +A++ + +++ ST Sbjct: 231 IASSSLDKTIRVWELSRGVCIRVIYGISPQYCIRFHPVNNNFLSAGNANKELTVFN-FST 289 Query: 441 ESIVK 455 I+K Sbjct: 290 GRIIK 294 >At1g15470.1 68414.m01860 transducin family protein / WD-40 repeat family protein Strong similarity to gb AF096285 serine-threonine kinase receptor-associated protein from Mus musculus and contains 5 PF|00400 WD40, G-beta repeat domains. EST gb|F14050 comes from this gene Length = 333 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHP 156 +GH + C+ + G + SGS D V +W + NHP Sbjct: 262 KGHHGPVHCVRYAPGGESYTSGSEDGTVRIW---VVGSVNHP 300 >At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat family protein similar to Will die slowly protein (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak) Length = 330 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 369 SPLNNSIITASADRHVRLYDPR 434 SP+N+S ++ S DR VRL+D R Sbjct: 123 SPINDSFMSGSLDRSVRLWDLR 144 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 28 YRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 ++GH + L +S + F SGS D +V LW Sbjct: 110 FKGHKDRVVSLCMSPINDSFMSGSLDRSVRLW 141 >At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); rab11 binding protein, Bos taurus, EMBL:AF117897 Length = 905 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNS-IITASADRHVRLYD 428 +LSS D +++WD + + A N V ++PL+ I+ S D +R+++ Sbjct: 533 LLSSSMDKTVRLWDIETQSCLKLFAHNDYVTCVQFNPLDEDYFISGSLDAKIRIWN 588 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 270 SSGWDHLLKIWDCDLGGIKQEIA 338 SS D LL IWDCD G K E A Sbjct: 393 SSAEDGLLNIWDCDRVGKKSERA 415 >At2g47010.2 68415.m05873 expressed protein Length = 451 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 252 GYNTVLSSGWDHLLKIWDCDLGGIKQEI 335 GY T L GW + WD D+GG+ + Sbjct: 422 GYPTRLGDGWVGDPRTWDLDVGGLSSRL 449 >At2g47010.1 68415.m05872 expressed protein Length = 451 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 252 GYNTVLSSGWDHLLKIWDCDLGGIKQEI 335 GY T L GW + WD D+GG+ + Sbjct: 422 GYPTRLGDGWVGDPRTWDLDVGGLSSRL 449 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHP 156 N V C+ R + C S S DG AS D V +W+ + E+ P Sbjct: 499 NEVSCI---RKSASKVICCSFSYDGKLLASAGHDKKVFIWNMETLQVESTP 546 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHP 156 N V C+ R + C S S DG AS D V +W+ + E+ P Sbjct: 501 NEVSCI---RKSASKVICCSFSYDGKLLASAGHDKKVFIWNMETLQVESTP 548 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHP 156 N V C+ R + C S S DG AS D V +W+ + E+ P Sbjct: 501 NEVSCI---RKSASKVICCSFSYDGKLLASAGHDKKVFIWNMETLQVESTP 548 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHP 156 N V C+ R + C S S DG AS D V +W+ + E+ P Sbjct: 501 NEVSCI---RKSASKVICCSFSYDGKLLASAGHDKKVFIWNMETLQVESTP 548 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHP 156 N V C+ R + C S S DG AS D V +W+ + E+ P Sbjct: 501 NEVSCI---RKSASKVICCSFSYDGKLLASAGHDKKVFIWNMETLQVESTP 548 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = +3 Query: 360 VDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFS 524 +DWS +N I+T S DR+ ++ E + V+WS + F+ Sbjct: 61 IDWSSKSNKIVTVSHDRNSYVWSLEGAEWVPTLVILRLNRAALCVQWSPKENKFA 115 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +3 Query: 342 NKAFFDVDWSPLNNSIITASADRHVRL--YDPRSTESIVKTTFTSHTGWVQSVRWSKTKT 515 N+A V WSP N S + V + Y+ + + K H V SV W Sbjct: 99 NRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNV 158 Query: 516 LFS 524 L + Sbjct: 159 LLA 161 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = +3 Query: 360 VDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFS 524 +DWS +N I+T S DR+ ++ E + V+WS + F+ Sbjct: 61 IDWSSKSNKIVTVSHDRNSYVWSLEGAEWVPTLVILRLNRAALCVQWSPKENKFA 115 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +3 Query: 342 NKAFFDVDWSPLNNSIITASADRHVRL--YDPRSTESIVKTTFTSHTGWVQSVRWSKTKT 515 N+A V WSP N S + V + Y+ + + K H V SV W Sbjct: 99 NRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNV 158 Query: 516 LFS 524 L + Sbjct: 159 LLA 161 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = +3 Query: 360 VDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFS 524 +DWS +N I+T S DR+ ++ E + V+WS + F+ Sbjct: 61 IDWSSKSNKIVTVSHDRNSYVWSLEGAEWVPTLVILRLNRAALCVQWSPKENKFA 115 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +3 Query: 342 NKAFFDVDWSPLNNSIITASADRHVRL--YDPRSTESIVKTTFTSHTGWVQSVRWSKTKT 515 N+A V WSP N S + V + Y+ + + K H V SV W Sbjct: 99 NRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHESSVTSVAWHPNNV 158 Query: 516 LFS 524 L + Sbjct: 159 LLA 161 >At1g73340.1 68414.m08489 cytochrome P450 family protein similar to Cytochrome P450 90A1 (SP:Q42569) [Arabidopsis thaliana]; contains Pfam profile: PF00067 cytochrome P450 Length = 512 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 403 ADAVIMLLFRGDQSTSKKALLPAISCLIPPKSQSQIFNK 287 AD +I LLF G+++TSK L PK+ +Q+ + Sbjct: 307 ADFIINLLFAGNETTSKTMLFAVYFLTHCPKAMTQLLEE 345 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 258 NTVLSSGWDHLLKIWDCDLGGIKQEIAGNKA-FFDVDWSPLNNSIITASADRHVRLYD 428 +T+++ D ++W G +A + V++SP + IIT SAD +R ++ Sbjct: 1033 DTLITGSDDWTARVWSVSRGSCDAVLACHAGPVQSVEYSPFDKGIITGSADGLLRFWE 1090 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 390 ITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTK 512 I+ S D V+++DP S ++ T HTG V+++ + K Sbjct: 871 ISGSTDCLVKIWDPSLRGSELRATLKGHTGTVRAISSDRGK 911 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTT 210 RGH+ ++ +S +A G+ A+ D +V +W + +PE + + Sbjct: 89 RGHESEVKSVSWNASGSLLATCGRDKSVWIW--------------EIQPEEDDEFDTIAV 134 Query: 211 LKGHKEAISGVQWMDT 258 L GH E + V W T Sbjct: 135 LTGHSEDVKMVLWHPT 150 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 28.7 bits (61), Expect = 3.3 Identities = 20/70 (28%), Positives = 30/70 (42%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTT 210 + H + L+VS+DG A+G D +V +W E ++ P H T + L Sbjct: 219 KNHSRESLALAVSSDGRYLATGGVDRHVHIWDVRTREH------VQAFPGHRNTVSCLCF 272 Query: 211 LKGHKEAISG 240 G E SG Sbjct: 273 RYGTSELYSG 282 >At3g61250.1 68416.m06855 myb family transcription factor (MYB17) contains PFAM profile: Myb-like DNA-binding domain PF00249 Length = 299 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +3 Query: 255 YNTVLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLNNSIITASA 404 Y+ V+ + DH L+IW+ ++G + +A SP + + T+SA Sbjct: 173 YSGVVKTECDHFLRIWNSEIGEAFRNLAPLDESTITSQSPCSRATSTSSA 222 >At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); related to En/Spm transposon family of maize Length = 465 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 31 RGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 +GH + CL V+ G+ SGS D +C+W Sbjct: 335 KGHKLAVLCLEVA--GSLVFSGSADKTICVW 363 Score = 27.5 bits (58), Expect = 7.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 37 HDKGIECLSVSADGNRFASGSWDNNVCLW 123 H + CLS++ + S SWD + +W Sbjct: 205 HADAVSCLSLNDEQGLLYSASWDRTIKVW 233 >At2g19540.1 68415.m02283 transducin family protein / WD-40 repeat family protein contains WD-40 repeats (PF00400); similar to Glutamate-rich WD repeat protein (GRWD) (SP:Q9BQ67)[Homo sapiens] Length = 469 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 22 ITYRGHDKGIECLSVS-ADGNRFASGSWDNNVCLWSASLAE 141 I + GH +E L S A+ N FAS S D +V +W L + Sbjct: 263 IPFAGHTASVEDLQWSPAEENVFASCSVDGSVAVWDIRLGK 303 >At1g64350.1 68414.m07292 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to nuclear pore protein SEH1 (SP:P53011) [Saccharomyces cerevisiae] Length = 326 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 40 DKGIECLSVSADGNRFASGSWDNNVCLWSASLAEEENHPATKK 168 D G C S + G+R A+GS + + ++ +S + T K Sbjct: 9 DSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSK 51 >At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, Homo sapiens, EMBL:HSU81006 Length = 627 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +3 Query: 471 HTGWVQSVRWSKTKTLF---SFLLDTTTRFKLWGNQGS 575 H GW+ SV W K F +FL+ TT F LWG+ + Sbjct: 392 HRGWM-SVAW-KAACFFPGIAFLILTTLNFLLWGSHST 427 >At5g19920.1 68418.m02370 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TipD protein (SP:O15736, PIR:T08602) [Dictyostelium discoideum]; related to WD-repeat protein RBAP1 (GI:9716495) [Zea mays] Length = 656 Score = 28.3 bits (60), Expect = 4.4 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 3/84 (3%) Frame = +3 Query: 318 GIKQEIAGNK-AFFDVDWSPLNNSIITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSV 494 G KQE + ++ A + WSP I + SAD + ++D R + +H V Sbjct: 573 GWKQESSESQSALINQSWSPDGLHISSGSADPVIHIFDIRYNAPSPSLSMKAHKKRVFKA 632 Query: 495 RW-SKTKTLFSFLLDTTTRF-KLW 560 W S L S D KLW Sbjct: 633 EWHSSYPLLVSISSDLAIGIHKLW 656 >At3g05090.2 68416.m00553 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 387 IITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTR 548 + T S D ++ + + TF SH WV + TL S DTT + Sbjct: 55 LFTGSRDGTLKRWAFDEDATFCSATFESHVDWVNDAALAGESTLVSCSSDTTVK 108 >At3g05090.1 68416.m00552 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to uncharacterized KIAA1449 protein (gi:7959157) [Homo sapiens] Length = 753 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 387 IITASADRHVRLYDPRSTESIVKTTFTSHTGWVQSVRWSKTKTLFSFLLDTTTR 548 + T S D ++ + + TF SH WV + TL S DTT + Sbjct: 55 LFTGSRDGTLKRWAFDEDATFCSATFESHVDWVNDAALAGESTLVSCSSDTTVK 108 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 264 VLSSGWDHLLKIWDCDLGGIKQEIAGNKAFFDVDWSPLN-NSIITASADRHVRLY 425 +LSS D +++WD + + A N + +SP++ N ++ S D +R++ Sbjct: 520 LLSSSMDKTVRLWDIETKTCLKLFAHNDYVTCIQFSPVDENYFLSGSLDAKIRIW 574 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 22 ITYRGHDKGIECLSVSADGNRFASGSWDNNVCLW 123 I +GH K + L+V + G R SGS+D V ++ Sbjct: 171 IQLKGHTKIVSSLAVDSAGARVLSGSYDYTVRMY 204 >At1g69400.2 68414.m07968 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 272 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 366 WSPLNNSIITASADRHVRLYDPRST 440 +SP +N+++ AS D ++RLYD S+ Sbjct: 21 FSPQSNNLLVASWDSYLRLYDVESS 45 >At1g69400.1 68414.m07969 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 314 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 366 WSPLNNSIITASADRHVRLYDPRST 440 +SP +N+++ AS D ++RLYD S+ Sbjct: 21 FSPQSNNLLVASWDSYLRLYDVESS 45 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 13 DCMITYRGHDKGIECLSVS-ADGNRFASGSWDNNVCLWSAS 132 +C+ T+ H+ + C++ + D N F SGS D V +W + Sbjct: 354 ECLRTFT-HNNFVTCVAFNPVDDNYFISGSIDGKVRIWDVT 393 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 13 DCMITYRGHDKGIECLSVS-ADGNRFASGSWDNNVCLWSAS 132 +C+ T+ H+ + C++ + D N F SGS D V +W + Sbjct: 354 ECLRTFT-HNNFVTCVAFNPVDDNYFISGSIDGKVRIWDVT 393 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 190 TRNPLTTLKGHKEAISGVQWMDTTQY 267 T LTTL GHK +++ W+ T+++ Sbjct: 48 TAQILTTLPGHKASVNCTHWLPTSKF 73 >At5g58760.1 68418.m07360 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); damage-specific DNA binding protein 2 (GI:10798819) [Homo sapiens] Length = 557 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = +3 Query: 234 LGCSMDGYNTVLSSGWDHLLKIWDCDLGGIK---QEIAGNKAFFDVDWSPLNNS-IITAS 401 L C+ +LS G DH +IWD K ++A + +SP + + I+T Sbjct: 318 LDCNPVQPELLLSCGNDHFARIWDMRKLQPKASLHDLAHKRVVNSAYFSPSSGTKILTTC 377 Query: 402 ADRHVRLYD 428 D +R++D Sbjct: 378 QDNRIRIWD 386 >At4g35050.1 68417.m04974 WD-40 repeat protein (MSI3) contains 5 WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI3 (SP:O22469) [Arabidopsis thaliana] Length = 424 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = +1 Query: 91 SGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTTLKGHKEAISGVQW 249 SGS D +CLW S AT K NP+ +GH+ I V W Sbjct: 187 SGSQDQRICLWDVSAT------ATDK-------VLNPMHVYEGHQSIIEDVAW 226 >At4g11920.1 68417.m01895 WD-40 repeat family protein contains 6 WD repeats (PF00400); similar to Fzr1 (GI:6463679) {Homo sapiens}; similar to WD repeat protein Srw1 -Schizosaccharomyces pombe,PID:d1023012 Length = 475 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 1 RNSVDCMITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWS 126 R D + +GH I L S+D ASG DN + +W+ Sbjct: 279 RTQEDHVSKLKGHKSEICGLKWSSDNRELASGGNDNKLFVWN 320 >At1g21650.1 68414.m02710 preprotein translocase secA family protein contains Pfam profiles: PF01043 SecA protein, amino terminal region, PF00400 WD domain, G-beta repeat, PF00097 zinc finger, C3HC4 type (RING finger) Length = 1579 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 19 MITYRGHDKGIECLSVSADGNRFASGSWDNNVCLWSAS 132 + T GH + L V +G + SGSWD V LWS S Sbjct: 620 LCTMSGHKSVVSTLVV-VNGVLY-SGSWDGTVRLWSLS 655 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 4 NSVDCMITYRGHDKGIECLSVS-ADGNRFASGSWDNNVCLWSAS 132 +S +C+ + H + C++ + D N F SGS D V +W S Sbjct: 393 SSDECIRVF-SHKSFVTCVAFNPVDDNYFISGSIDGKVRIWDVS 435 >At4g32330.2 68417.m04600 expressed protein Length = 436 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +1 Query: 64 VSADGNRFA---SGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTTLKGHKEAI 234 ++ADG A G NVC+ E T +S+ E+ + L T++ KEA Sbjct: 7 MAADGTDSAPANGGLAMENVCVKENGAVSVETVDTTSESQNENSANSSTLDTIEHVKEAA 66 Query: 235 SGVQ 246 G Q Sbjct: 67 EGTQ 70 >At4g32330.1 68417.m04599 expressed protein Length = 437 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +1 Query: 64 VSADGNRFA---SGSWDNNVCLWSASLAEEENHPATKKSKPEHGTTRNPLTTLKGHKEAI 234 ++ADG A G NVC+ E T +S+ E+ + L T++ KEA Sbjct: 7 MAADGTDSAPANGGLAMENVCVKENGAVSVETVDTTSESQNENSANSSTLDTIEHVKEAA 66 Query: 235 SGVQ 246 G Q Sbjct: 67 EGTQ 70 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,702,073 Number of Sequences: 28952 Number of extensions: 320089 Number of successful extensions: 1506 Number of sequences better than 10.0: 152 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1489 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -