BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30704 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 33 0.007 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 32 0.015 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 32 0.015 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 32 0.015 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 32 0.015 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 32 0.015 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 31 0.026 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 30 0.046 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 29 0.14 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 29 0.14 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 29 0.14 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 29 0.14 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 27 0.33 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 3.0 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 23 5.3 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 23 5.3 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 7.0 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 23 7.0 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 33.1 bits (72), Expect = 0.007 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S SI H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSSIQHHAAPAIH 44 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 31.9 bits (69), Expect = 0.015 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 31.9 bits (69), Expect = 0.015 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 31.9 bits (69), Expect = 0.015 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 31.9 bits (69), Expect = 0.015 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 31.9 bits (69), Expect = 0.015 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 31.1 bits (67), Expect = 0.026 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIASSHSTIQHHAAPAIH 44 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 30.3 bits (65), Expect = 0.046 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 K V+L LVA AGLL PV + A S SI H P +H Sbjct: 4 KFVLLATLVAAVSAGLL--PVANHGSIATSHSSIQHHAAPAIH 44 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 28.7 bits (61), Expect = 0.14 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 133 K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.7 bits (61), Expect = 0.14 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 133 K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 28.7 bits (61), Expect = 0.14 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 133 K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 28.7 bits (61), Expect = 0.14 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 133 K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 4 KFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.5 bits (58), Expect = 0.33 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 8 KIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 133 K V+ LVA + AGLL PV + + A S +I H +P + Sbjct: 4 KFVLFTTLVAAASAGLL--PVAHHGSIATSHSTIQHHARPAI 43 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.2 bits (50), Expect = 3.0 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 3 SPKS*YCVL--WSRCRKLDFWLLPCTTLPLKPFLPKALCA 116 SP Y V WS C+KL F C P P LC+ Sbjct: 20 SPTGVYSVRRRWSLCQKLHFRDQVCCVQRSPPHWPYLLCS 59 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 11 IVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 + +L ALV + +++A Y AE V S + + P LH Sbjct: 12 LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 11 IVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 136 + +L ALV + +++A Y AE V S + + P LH Sbjct: 12 LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 172 PRGPCSVPGRPSCLPRGPCSVPG-RPSCLHTSPLRYS 279 P PG S P GP +P RP+ + LR+S Sbjct: 111 PSAASESPGSVSSQPSGPIHIPAKRPAFDTDTRLRHS 147 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 23.0 bits (47), Expect = 7.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 124 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSC 252 A A C C PC +P + G L G C P R C Sbjct: 15 ALATLCHGACDEPCPVPPKHYAELGCKPILEEGQC-CPKRYQC 56 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,328 Number of Sequences: 2352 Number of extensions: 8070 Number of successful extensions: 33 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -