Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30704
         (569 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective...    24   0.92 
U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive o...    21   8.6  
AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin ...    21   8.6  

>AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective
           protein-1 protein.
          Length = 128

 Score = 24.2 bits (50), Expect = 0.92
 Identities = 11/31 (35%), Positives = 13/31 (41%)
 Frame = +1

Query: 124 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLP 216
           A   +C    C  CS  +  CS    P CLP
Sbjct: 80  AEGMQCSCNKCIGCSAEKFECSKTSNP-CLP 109


>U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive
           opsin protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 54  FWLLPCTTLPL 86
           FW+ P T LPL
Sbjct: 180 FWVTPFTVLPL 190


>AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin
           protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 54  FWLLPCTTLPL 86
           FW+ P T LPL
Sbjct: 180 FWVTPFTVLPL 190


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,830
Number of Sequences: 438
Number of extensions: 1993
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16381902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)