BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30701 (749 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 3.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.6 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 4.6 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.6 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 4.6 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/17 (58%), Positives = 12/17 (70%), Gaps = 2/17 (11%) Frame = +3 Query: 234 QPYPVHVQW--SNLSMY 278 +PYPV+ QW LSMY Sbjct: 261 RPYPVYNQWWSGPLSMY 277 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 511 FKNLIGCESKP 479 FKNL GCE P Sbjct: 2170 FKNLCGCEEYP 2180 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +3 Query: 210 QYVKVPIPQPYPVHVQWSNLSMYLFIRLSTKLLKNQYRTRSKNQCPMKSKSLI 368 QY++ + Y V V NLS +L R L R+ N S +++ Sbjct: 171 QYLRSTLSDRYKVFVDLFNLSTFLIPRSYIPPLSTSMRSHLCNWGSANSTNIV 223 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +3 Query: 210 QYVKVPIPQPYPVHVQWSNLSMYLFIRLSTKLLKNQYRTRSKNQCPMKSKSLI 368 QY++ + Y V V NLS +L R L R+ N S +++ Sbjct: 331 QYLRSTLSDRYKVFVDLFNLSTFLIPRSYIPPLSTSMRSHLCNWGSANSTNIV 383 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +3 Query: 210 QYVKVPIPQPYPVHVQWSNLSMYLFIRLSTKLLKNQYRTRSKNQCPMKSKSLI 368 QY++ + Y V V NLS +L R L R+ N S +++ Sbjct: 331 QYLRSTLSDRYKVFVDLFNLSTFLIPRSYIPPLSTSMRSHLCNWGSANSTNIV 383 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,276 Number of Sequences: 336 Number of extensions: 4561 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -