BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30693 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_49800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 >SB_13698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 309 TKQRLFLTILLGFYFTILQAYEYIEASFTIADRIYGSTFFI 431 T R+FL IL+ F L + Y A+FT ++ T FI Sbjct: 247 TGSRMFLDILIAFIIPYLLWFAYTIANFTFKPKLSFETEFI 287 >SB_49800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +3 Query: 285 LIENNFSQTKQRLFLTILLGFYFTILQAYEYIE--ASFTIADRIYGSTFFIATGFHGIHV 458 ++E N + K R+ + + +L Y Y + + + DRI ++ T GI+V Sbjct: 41 ILEENDPKNKYRINVHSIFWMTAAMLVFY-YTDFYIAVKVDDRINRPWLYLGTALIGINV 99 Query: 459 IIGTLFLLIC 488 I+G F++ C Sbjct: 100 IVGLYFVVWC 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,722,528 Number of Sequences: 59808 Number of extensions: 238087 Number of successful extensions: 386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -