BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30689 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 26 0.39 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 2.8 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 4.8 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 8.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.4 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 25.8 bits (54), Expect = 0.39 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 676 QPLFPLGPGLTWRGSKPLGNPLLRAVVSGPPDGCSP 783 +PL P G+ G+ PL +P L A+ PP P Sbjct: 186 RPLLPPSFGIFPGGAPPLVSPFLAAMAHRPPHFAFP 221 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +1 Query: 160 LPSGQLLEI--RSERASESSDCGNG 228 LP +LL+ +S R SS CGNG Sbjct: 26 LPEEKLLDALCQSFRKQNSSSCGNG 50 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 761 PETTARSKGFPKGLLPLQVKPG 696 P A S+ P LLPL +PG Sbjct: 328 PSDGATSEALPFELLPLDSEPG 349 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 775 NRPAVRKRPPEAKDFPRV 722 N+P V +PP+A F V Sbjct: 187 NKPVVVTKPPQAPPFATV 204 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 8.4 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = +2 Query: 614 CQPVIVLPSFKSPPTIRQPLGNRYSPLALV*LGGEANPWEIL 739 C P+I L P + L N Y L + + E N W L Sbjct: 494 CDPLITLIETWMPLLPQWILDNIYDQLIMPRIQAEVNIWNPL 535 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,663 Number of Sequences: 336 Number of extensions: 4602 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -