BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30687 (837 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 25 0.98 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 4.0 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.6 bits (51), Expect = 0.98 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 282 STFQQINFERRTFKPFNIF 226 STF I F R +K FNIF Sbjct: 400 STFSDITFMRTVWKFFNIF 418 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -3 Query: 145 HPNFFHCE*KAGKVVT*ELCQFYTFLFLSVLKIVYFW 35 HP +F + + T + C F +LSV I+ ++ Sbjct: 303 HPTYFGKTGRKTVLKTNKYCNFIILFYLSVFVILVYY 339 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,763 Number of Sequences: 336 Number of extensions: 5137 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -