BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30684 (831 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.49 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.49 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 8.0 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.8 bits (54), Expect = 0.49 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 479 RLQGYSLELRRHDKGVLLRSERANLCLYRVELNQVQFTPFGDSPQR--VLHFR 327 +L+G + +D+GV ++ N+ ++V+F GD R +L+FR Sbjct: 354 KLKGLCPSMANYDRGVFYKNYLLNVSFIDAAGSEVKFDEHGDGLARYEILNFR 406 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 25.8 bits (54), Expect = 0.49 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 479 RLQGYSLELRRHDKGVLLRSERANLCLYRVELNQVQFTPFGDSPQR--VLHFR 327 +L+G + +D+GV ++ N+ ++V+F GD R +L+FR Sbjct: 444 KLKGLCPSMANYDRGVFYKNYLLNVSFIDAAGSEVKFDEHGDGLARYEILNFR 496 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 8.0 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 608 TPGTKGFLLYKAQVPGLAWSYLLPIFLGPGAPK 706 T GT+ L + AW LL +G G P+ Sbjct: 600 TDGTEEDALNLSSAVWFAWGVLLNSGIGEGTPR 632 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 268,641 Number of Sequences: 438 Number of extensions: 6583 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -