BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30682 (625 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C su... 60 2e-09 At4g10660.1 68417.m01741 hypothetical protein 29 1.9 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 5.8 At3g13080.4 68416.m01638 ABC transporter family protein almost i... 28 5.8 At3g13080.3 68416.m01637 ABC transporter family protein almost i... 28 5.8 At3g13080.2 68416.m01636 ABC transporter family protein almost i... 28 5.8 At3g13080.1 68416.m01635 ABC transporter family protein almost i... 28 5.8 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 5.8 At5g22110.1 68418.m02574 DNA polymerase epsilon subunit B family... 27 7.7 At4g15215.1 68417.m02332 ABC transporter family protein similar ... 27 7.7 At1g29220.1 68414.m03574 transcriptional regulator family protei... 27 7.7 >At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C subunit family protein similar to ATPase subunit 9 [Arabidopsis thaliana] GI:15215920; contains Pfam profile PF00137: ATP synthase subunit C Length = 85 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +3 Query: 255 ATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 389 AT+ AG+ GIG VF SLI ARNPSL +Q F YAILGFAL+E Sbjct: 24 ATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTE 68 >At4g10660.1 68417.m01741 hypothetical protein Length = 317 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 447 IYF*EHYYCHPTYGVSV-YTMLSRTAMESDVWKPHR 551 +Y +H+YC + GV V + + SRT M W HR Sbjct: 151 VYANDHFYCFSSGGVLVDFDVASRT-MSEQAWNEHR 185 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 35 LIKTKCCLPPD*SPLQPGLPSSATLH--WCDHLQQYPPI 145 L++ CC + P LPS LH +C LQ +P I Sbjct: 682 LLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEI 720 >At3g13080.4 68416.m01638 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1120 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -3 Query: 368 NGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCRAPAPMNLAAESMSLVTDV 201 NGV E+ LL GG + D+ E SG + + RA L MS + D+ Sbjct: 211 NGVLEEPLLNGGDSRVGGDDSVELNKTNGSGEATPYSRAGILSLLTFSWMSPLIDI 266 >At3g13080.3 68416.m01637 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1120 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -3 Query: 368 NGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCRAPAPMNLAAESMSLVTDV 201 NGV E+ LL GG + D+ E SG + + RA L MS + D+ Sbjct: 211 NGVLEEPLLNGGDSRVGGDDSVELNKTNGSGEATPYSRAGILSLLTFSWMSPLIDI 266 >At3g13080.2 68416.m01636 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1489 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -3 Query: 368 NGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCRAPAPMNLAAESMSLVTDV 201 NGV E+ LL GG + D+ E SG + + RA L MS + D+ Sbjct: 211 NGVLEEPLLNGGDSRVGGDDSVELNKTNGSGEATPYSRAGILSLLTFSWMSPLIDI 266 >At3g13080.1 68416.m01635 ABC transporter family protein almost identical to MRP-like ABC transporter GI:2316016 from [Arabidopsis thaliana]; contains Pfam profile: PF00005 ABC transporter Length = 1514 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -3 Query: 368 NGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCRAPAPMNLAAESMSLVTDV 201 NGV E+ LL GG + D+ E SG + + RA L MS + D+ Sbjct: 211 NGVLEEPLLNGGDSRVGGDDSVELNKTNGSGEATPYSRAGILSLLTFSWMSPLIDI 266 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -3 Query: 239 NLAAESMSLVTDVVWKDRTAESCVGTAGTICVWVGTAASGRTS 111 N+A+E + L+ ++ CV +C+ VG ++SG+TS Sbjct: 2028 NIASEQLKLLPEIRQNLEAVAHCVQNKW-LCILVGPSSSGKTS 2069 >At5g22110.1 68418.m02574 DNA polymerase epsilon subunit B family contains Pfam profile: PF04042 DNA polymerase epsilon subunit B Length = 523 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +2 Query: 191 PSRPHRSLRTLTLLPNSLVLVRDSGSSWFRSWYWNSLRLPHH 316 P P S +L ++ ++ ++ +D W R + W++ LP H Sbjct: 85 PEEPTTSASSLAII-DAFLVPKDEFDRWLRVYVWHTSSLPIH 125 >At4g15215.1 68417.m02332 ABC transporter family protein similar to PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1390 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 418 RSCCSSLSKLFTFKNTTTAILHMG 489 RS +++ +L TFK TTA+LH G Sbjct: 31 RSQWATVERLPTFKRVTTALLHTG 54 >At1g29220.1 68414.m03574 transcriptional regulator family protein similar to Transcriptional regulator protein HCNGP (Swiss-Prot:Q02614) [Mus musculus] Length = 351 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 335 GVPGIADDEGAEDCSNTSSGTSYSHCRAPAPMNLAAESMSLVTD 204 G G+AD E +D S SS T P P +E + D Sbjct: 107 GESGVADGERGDDASGESSDTLLDQFLPPRPRERCSEELQRKID 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,958,735 Number of Sequences: 28952 Number of extensions: 335476 Number of successful extensions: 1210 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1208 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -