BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30680 (793 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0241 - 8204430-8205398 30 2.4 07_02_0006 - 11663297-11663308,11663587-11663783,11663860-116639... 28 9.8 >02_02_0241 - 8204430-8205398 Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -1 Query: 580 SPLTITIEHSKIVYELIFFNVSRVARSCESWDIPIRYCSPSRIAHCGTAQTN-HCWIWSF 404 +P+ + EH++ V+ L + V R A SWD ++ SP R A T + + +C + Sbjct: 102 NPVRLLREHAREVHGLDWNPVRRDAFLSASWDDTLKLWSPDRPASVRTFRGHEYCVYAAA 161 Query: 403 WNLR 392 W+ R Sbjct: 162 WSAR 165 >07_02_0006 - 11663297-11663308,11663587-11663783,11663860-11663948, 11664087-11664166,11664747-11664851,11664951-11665031, 11665135-11665218,11665352-11665449,11666203-11666297, 11666380-11666453,11666549-11666826,11666920-11667190 Length = 487 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 377 LKAAAMKAIFPRMYALNTAKAMMARNKGIRAANLSLRRA 261 + AA + PR+ T +A +++GI+ LSLRRA Sbjct: 46 MAAALLPETAPRLLTPETIRAAAKQSQGIQLVPLSLRRA 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,683,947 Number of Sequences: 37544 Number of extensions: 382961 Number of successful extensions: 903 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -