BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30680 (793 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY941960-1|AAY33309.1| 124|Homo sapiens anti-rabies virus immun... 33 1.2 AY941910-1|AAY33259.1| 124|Homo sapiens anti-rabies virus immun... 33 1.2 AY941851-1|AAY33200.1| 124|Homo sapiens anti-rabies virus immun... 33 1.2 >AY941960-1|AAY33309.1| 124|Homo sapiens anti-rabies virus immunoglobulin heavy chain variable region protein. Length = 124 Score = 33.1 bits (72), Expect = 1.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 505 RSCESWDIPIRYCSPSRIAHCGTAQTNHCWIWSFW 401 RS S D + YC+ R+A+CG C+ W +W Sbjct: 84 RSLRSDDTAVYYCARDRLAYCG----GDCYSWDYW 114 >AY941910-1|AAY33259.1| 124|Homo sapiens anti-rabies virus immunoglobulin heavy chain variable region protein. Length = 124 Score = 33.1 bits (72), Expect = 1.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 505 RSCESWDIPIRYCSPSRIAHCGTAQTNHCWIWSFW 401 RS S D + YC+ R+A+CG C+ W +W Sbjct: 84 RSLRSDDTAVYYCARDRLAYCG----GDCYSWDYW 114 >AY941851-1|AAY33200.1| 124|Homo sapiens anti-rabies virus immunoglobulin heavy chain variable region protein. Length = 124 Score = 33.1 bits (72), Expect = 1.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 505 RSCESWDIPIRYCSPSRIAHCGTAQTNHCWIWSFW 401 RS S D + YC+ R+A+CG C+ W +W Sbjct: 84 RSLRSDDTAVYYCARDRLAYCG----GDCYSWDYW 114 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,098,538 Number of Sequences: 237096 Number of extensions: 2063315 Number of successful extensions: 7897 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7897 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9701808132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -