BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30679 (834 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1396 + 29855256-29855328,29856019-29856180,29856466-298565... 29 3.5 01_06_0997 + 33676441-33676758,33678223-33678314,33678443-336785... 29 6.0 >06_03_1396 + 29855256-29855328,29856019-29856180,29856466-29856516, 29857189-29857277,29857632-29857709,29857811-29858014, 29858101-29858172,29858262-29858306 Length = 257 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 338 IQAGYPVEFFVGFINKGSVDYVVESMEASFRYPMDYTYYIQNFT 469 + AG E VG N+G V ++ ++ P D+ Y QN T Sbjct: 80 VLAGEETELLVGLQNEGESTLNVVAIHSTLHLPFDHKMYGQNLT 123 >01_06_0997 + 33676441-33676758,33678223-33678314,33678443-33678540, 33678824-33678979,33679106-33679731,33679826-33679896, 33679987-33680241,33680337-33680454,33680595-33680766, 33680854-33681395 Length = 815 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 691 LPWCWWSIGLSSQDSKLLRIIW 756 L W WWSIG+S+ DS++L I + Sbjct: 91 LVW-WWSIGVSAVDSQVLYIAY 111 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,802,089 Number of Sequences: 37544 Number of extensions: 447072 Number of successful extensions: 982 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -