BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30679 (834 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024852-1|AAK66027.1| 257|Caenorhabditis elegans Hypothetical ... 75 8e-14 >AC024852-1|AAK66027.1| 257|Caenorhabditis elegans Hypothetical protein Y71F9AM.6 protein. Length = 257 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/76 (43%), Positives = 48/76 (63%) Frame = +2 Query: 281 DTTILFTKPVPSLGDLTFDIQAGYPVEFFVGFINKGSVDYVVESMEASFRYPMDYTYYIQ 460 D + F PS ++ + G PV++ +GF NKG D+VV+ E SFR+P D++Y++Q Sbjct: 48 DAGLAFHFVQPSDANVVREFYTGKPVKYLIGFQNKGEKDFVVKYAETSFRFPTDHSYHLQ 107 Query: 461 NFTALPYNREVKPKQE 508 NFT YNR V PK+E Sbjct: 108 NFTRGEYNRRVAPKEE 123 Score = 68.9 bits (161), Expect = 4e-12 Identities = 36/88 (40%), Positives = 47/88 (53%) Frame = +1 Query: 424 FPLSNGLHILHSELHRVAL*QRS*AKTGTTFAYSFIPNEAFAGRPFGLNVQLNYRDASGN 603 FP + H+ R +R K T Y F +E FAGRP GL V ++Y+DA GN Sbjct: 98 FPTDHSYHL--QNFTRGEYNRRVAPKEEVTLDYGFYAHETFAGRPVGLVVNVHYQDADGN 155 Query: 604 AYQEAVYNQTLNIVEVSEGLDGETFLLY 687 + VYNQT+NI+E G GET L+ Sbjct: 156 VFVNNVYNQTINIMEDDSGFSGETGFLF 183 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,499,920 Number of Sequences: 27780 Number of extensions: 384514 Number of successful extensions: 948 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -