BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30679 (834 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 23 2.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.1 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 447 HTTFRTSPRCLITEKLSQNRNHLCLFLYT 533 H + RC+I E++ +RN L +YT Sbjct: 29 HAERQEEYRCVICERVYCSRNSLMTHIYT 57 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 3.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 394 RLCSRIHGGIFPLSNGLHILHSELHRVA 477 R C R H + + ++ H ELHR A Sbjct: 108 RKCPRRHRPVCASNGKIYANHCELHRAA 135 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 6.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 660 TFRYFHNVQCLVVDGFLVSISAGVSVIKLYI 568 T+RY + L V GF+ + AG I LYI Sbjct: 224 TYRYGFSF-LLYVSGFITTEVAGTYAIFLYI 253 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,036 Number of Sequences: 438 Number of extensions: 5059 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -