BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30679 (834 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21160.1 68415.m02510 translocon-associated protein alpha (TR... 34 0.13 At4g16130.1 68417.m02444 GHMP kinase family protein contains GHM... 28 6.6 At3g47150.1 68416.m05119 F-box family protein various predicted ... 28 6.6 At3g49900.1 68416.m05455 BTB/POZ domain-containing protein conta... 28 8.8 >At2g21160.1 68415.m02510 translocon-associated protein alpha (TRAP alpha) family protein contains Pfam profile: PF03896 translocon-associated protein (TRAP), alpha subunit Length = 258 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +2 Query: 338 IQAGYPVEFFVGFINKGSVDYVVESMEASFRYPMDYTYYIQNFTALPYNREVKP 499 + AG E VG N+G V + AS P D+ +QN T L N P Sbjct: 78 VPAGEETELLVGLKNEGKTRVGVMGIRASVHLPYDHKLLVQNLTMLRLNNASIP 131 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/61 (34%), Positives = 27/61 (44%) Frame = +1 Query: 511 TFAYSFIPNEAFAGRPFGLNVQLNYRDASGNAYQEAVYNQTLNIVEVSEGLDGETFLLYG 690 TF Y F ++ F L + Y D G YQ YN T+ +VE L GE+ L Sbjct: 137 TFPYIFAVSQYLQPGAFDLVGYIIY-DVEGKPYQSVFYNGTIEVVESGGLLSGESVFLLT 195 Query: 691 L 693 L Sbjct: 196 L 196 >At4g16130.1 68417.m02444 GHMP kinase family protein contains GHMP kinases putative ATP-binding protein domain, Pfam:PF00288 Length = 1039 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 673 SLHLDLQILPQCSVSGCRRLPGKHFRWR 590 SL L + I C V+ R LPGKH W+ Sbjct: 570 SLVLQMPIREACHVAVQRNLPGKHRLWK 597 >At3g47150.1 68416.m05119 F-box family protein various predicted proteins, Arabidopsis thaliana Length = 360 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 426 SAIQWTTHTTFRTSPRCLITEKLSQNRNHLCLFLY 530 S + + TF T CL+TEK+S + CLF Y Sbjct: 288 SGLDFKVMNTFYTGEICLVTEKIS---DPFCLFYY 319 >At3g49900.1 68416.m05455 BTB/POZ domain-containing protein contains BTB/POZ domain, INTERPRO:IPR000210 Length = 517 Score = 27.9 bits (59), Expect = 8.8 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -2 Query: 449 MCSPLDSGKMPPWILLHSLRNP 384 +C+ +D K+ P +LLH+++NP Sbjct: 269 ICNSIDCDKLSPPLLLHAVQNP 290 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,514,056 Number of Sequences: 28952 Number of extensions: 360958 Number of successful extensions: 857 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1921616800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -