BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30672 (486 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IL15 Cluster: Putative uncharacterized protein; n=1; ... 33 4.5 >UniRef50_Q8IL15 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1001 Score = 32.7 bits (71), Expect = 4.5 Identities = 22/73 (30%), Positives = 38/73 (52%) Frame = +3 Query: 243 YS*IVKIDFFSGILTLN*STVKFTHCRLITLAFQASKCIIILTD*YIFYYCILEWSSKFV 422 Y+ I+K + +LT+N ++ I L FQ++ IIL+ +IF+Y + S+ Sbjct: 407 YTHILKYNKMWNVLTINDKLLQDEEQNSILLGFQSNYLFIILSLLFIFFYININLSTFVT 466 Query: 423 CFECILSEICVKL 461 + I+ ICV L Sbjct: 467 YTKKIVLLICVYL 479 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 413,854,653 Number of Sequences: 1657284 Number of extensions: 6903582 Number of successful extensions: 12989 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 12556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12979 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 28130105105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -