BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30672 (486 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_13140| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-15) 27 8.2 SB_3110| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1900 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -1 Query: 189 WLLPIIYVQS--SYCRLVTFAVQASIWLI-CNLHTKNIRIKTVNAYTQ 55 W+ I+Y+Q SY + V + + LI C ++++ I KT++AY++ Sbjct: 337 WISLILYIQRLPSYGKYVIMLYRMFVTLIKCGIYSRRIYQKTIDAYSR 384 >SB_13140| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-15) Length = 987 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 144 VTFAVQASIWLICNLHTKNIRIKTVNAYT 58 V F VQ +W H K +++ T+ +YT Sbjct: 611 VLFLVQIQVWSSLRRHRKKLKLMTLPSYT 639 >SB_3110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 27.1 bits (57), Expect = 8.2 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 357 IIILTD*YIFYYCILEWSSKFVCFECILSEICVKL 461 + I+ + +++ L W S+F E ++ +IC L Sbjct: 85 LFIIDRDFAYFFLTLWWCSRFALIEFLIEQICCSL 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,116,974 Number of Sequences: 59808 Number of extensions: 227912 Number of successful extensions: 419 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -