BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30670 (664 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 26 0.92 AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 25 2.8 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 3.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 4.9 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 8.6 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 26.2 bits (55), Expect = 0.92 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 580 ERSPPRYLLVVNGVLELKRSRRQRQSKLD*KAN 482 ++ PPRYL V + ELKR +QR+ +L + N Sbjct: 696 QQKPPRYLQV--SMDELKRHTQQRREQLQRELN 726 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 310 DHSQQERGHSYDHRYRYWDDQRRFWGQF 393 D +QE G ++DH +W R F F Sbjct: 34 DEQKQELGLNFDHDGEFWMSYRDFTRYF 61 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -2 Query: 528 NGHAVSDKVNWIRKPTPKLSKSC*CRHLLEE 436 +GHA+ D + + + P++ + CRH +E Sbjct: 405 DGHALIDLLQRVDENPPEVGQKVLCRHPFQE 435 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 110 CLHFFRHFLYCFLFNSHKMTRGFLTHVFQS 21 C F HF Y F F+S F +F S Sbjct: 945 CFRLFNHFYYLFDFDS--SLNSFRNRIFSS 972 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.0 bits (47), Expect = 8.6 Identities = 6/11 (54%), Positives = 11/11 (100%) Frame = -1 Query: 391 IVPKIAFGHPN 359 ++PK+AFG+P+ Sbjct: 47 VIPKVAFGYPD 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,356 Number of Sequences: 2352 Number of extensions: 16860 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -