BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30670 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.6 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 6.0 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 2.6 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 213 ELISNSSDALDKIRMNLSRIRQNSIVAKSCTSRSFPTRTRALLRSSIPVLG*PKAIL 383 +++S L K R L+ + + VAK S P + + SSIP L A++ Sbjct: 321 QVVSQLEIQLQKERDRLTAMMHHLHVAKQMASPEPPKSSESSTGSSIPKLNLSTALM 377 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/29 (27%), Positives = 13/29 (44%) Frame = +1 Query: 289 WQRAVHQDHSQQERGHSYDHRYRYWDDQR 375 W +H D + GH + +Y D +R Sbjct: 491 WMGVLHGDEVEYVFGHPLNKSLKYSDKER 519 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,668 Number of Sequences: 438 Number of extensions: 4271 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -