BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30668 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 24 1.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 5.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 5.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 5.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 5.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 5.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 5.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 5.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.6 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 21 8.8 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 8.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.8 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 15 AHASCICWCYCSRRPSPL 68 A S IC C+C RR + L Sbjct: 72 AFKSIICKCFCKRRTNTL 89 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 15 AHASCICWCYCSRRPSPL 68 A S IC C+C RR + L Sbjct: 520 AFKSIICKCFCKRRTNTL 537 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 33 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 69 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 590 SSLSYAILVFNNYLFKKNICKLFY*NIKH 676 SSLS + NNY N KL+Y NI + Sbjct: 305 SSLSNSCNYSNNYYNNNNYKKLYY-NINY 332 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 281 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 317 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 49 RVGRRRSTLLQSNANRRFKRSGRLREYCVSNRNPAED 159 R RRR + + + +K REY ++R + D Sbjct: 282 RTSRRRYSRSREREQKSYKNEREYREYRETSRERSRD 318 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 205 QRKRQSATEQSRCPSNGA 258 Q+K+ T+QS+ PS+GA Sbjct: 3 QQKQPIITQQSQQPSSGA 20 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.4 bits (43), Expect = 8.8 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -2 Query: 167 INSSSAGLRLETQYSRSRPERLNRLFAFDCSSVERRR 57 +N++ R T Y+R + L + F F+ RRR Sbjct: 2 VNANGEVKRQRTSYTRYQTLELEKEFHFNRYLTRRRR 38 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 543 EPVPEVVFYIILR 581 EP P++VF I LR Sbjct: 221 EPYPDIVFNITLR 233 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 427 CGPGRERDPDTLGCRASAV 483 CGPG+ D GC A+ Sbjct: 488 CGPGKWPHEDKRGCYQLAI 506 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -1 Query: 480 CTSSTAESVRVPLPTWSTLFCSTNKF*LISLISQSVCIETPSTR 349 C S+T + R P + L C+T+ + + SV T R Sbjct: 751 CASTTTITARSPQGSQGLLQCATSNYSTTRWPATSVITTTTGAR 794 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 427 CGPGRERDPDTLGCRASAV 483 CGPG+ D GC A+ Sbjct: 578 CGPGKWPHEDKRGCYQLAI 596 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,972 Number of Sequences: 438 Number of extensions: 3735 Number of successful extensions: 26 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -