BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30662 (724 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 1.9 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 1.9 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 3.3 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 5.8 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 441 RRMRGWPSRLNTTLL-LAPMTFAVVFRHRQIRISCWYSNV 325 +R R PSR+NT L+ LA V F + I W S V Sbjct: 79 KRRRKTPSRINTMLMHLAIADLLVTFLMMPLEIG-WASTV 117 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 441 RRMRGWPSRLNTTLL-LAPMTFAVVFRHRQIRISCWYSNV 325 +R R PSR+NT L+ LA V F + I W S V Sbjct: 79 KRRRKTPSRINTMLMHLAIADLLVTFLMMPLEIG-WASTV 117 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 133 KRRVFGVTEEQGQTHHQNKTRR 198 + +++GV EE +T H N+ R Sbjct: 339 REKIYGVLEEYTRTTHPNEPGR 360 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 595 LMPVYC*ANVFQPIGFYRIRTFSLE 669 L P++ +F + +Y FSLE Sbjct: 11 LRPIFAVCRLFALVPYYNFEKFSLE 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,053 Number of Sequences: 336 Number of extensions: 3094 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -