BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30662 (724 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0260 - 21761145-21762416 28 6.5 06_01_0144 + 1089090-1091390 28 8.6 >11_06_0260 - 21761145-21762416 Length = 423 Score = 28.3 bits (60), Expect = 6.5 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = +2 Query: 71 YDREIDSARYKQIPKIHDYVLNEEYLASQKNRAKLITRIRPDEPVVADNVILESNVVKIV 250 Y + D + +I + DYVL + +S AK +RP +AD+ E + K Sbjct: 324 YKVDFDDQKLDKIDSLKDYVLFLGFNSSICLSAKEFPNLRPGCAYLADDSYEEIGINKHT 383 Query: 251 RPRRGKWNATS 283 G WN S Sbjct: 384 LREVGIWNFKS 394 >06_01_0144 + 1089090-1091390 Length = 766 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +2 Query: 74 DREIDSARYKQIPKIHDYVLNEE---YLASQKNRAKLITRIRPDEPVVADNVILESNVV 241 DRE YK + K L YL+S+++R + I +R D AD +LE V Sbjct: 626 DREGTERIYKDLKKGIKAALGGARGYYLSSERSRHETIRALRVDASAAADMTVLERGAV 684 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,228,818 Number of Sequences: 37544 Number of extensions: 337923 Number of successful extensions: 704 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -