BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30662 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 prot... 27 0.78 U21917-1|AAA73920.1| 271|Anopheles gambiae serine protease prot... 24 5.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 7.2 >AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 protein. Length = 250 Score = 26.6 bits (56), Expect = 0.78 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = -1 Query: 319 SCIRALIALVPYRCRVPLTSSRSHYLDHVRFQNNIICHYRFVGSYSGDEFGPVLL*RQIL 140 +C+ L+A R L H+ D FQ + + + + +EF P+LL ++++ Sbjct: 45 TCMHTLLAREHNRIATELGKINPHWDDETLFQESRRINIAIIQHITYNEFLPILLGKEVM 104 >U21917-1|AAA73920.1| 271|Anopheles gambiae serine protease protein. Length = 271 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 193 GSYSGDEFGPVLL*RQILFV*NVIVNF 113 G+ +GD GP +L Q++ N I+N+ Sbjct: 219 GACNGDSGGPAILNNQLVGRPNFIINY 245 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 532 LANCNAHC*EMRSRPNR 482 +A C +HC E R + NR Sbjct: 278 IAQCRSHCIEARRKMNR 294 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,724 Number of Sequences: 2352 Number of extensions: 13118 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -