BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30662 (724 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC029505-1|AAH29505.1| 509|Homo sapiens zinc finger protein 683... 31 5.5 AL451139-19|CAI15853.1| 509|Homo sapiens novel protein protein. 31 5.5 >BC029505-1|AAH29505.1| 509|Homo sapiens zinc finger protein 683 protein. Length = 509 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 289 PYRCRVPLTSSRSHYLDHVRFQNNIICHYRFVGS 188 P++C +P R+H+ ++ +CH RF S Sbjct: 362 PHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSS 395 >AL451139-19|CAI15853.1| 509|Homo sapiens novel protein protein. Length = 509 Score = 30.7 bits (66), Expect = 5.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 289 PYRCRVPLTSSRSHYLDHVRFQNNIICHYRFVGS 188 P++C +P R+H+ ++ +CH RF S Sbjct: 362 PHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSS 395 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,583,796 Number of Sequences: 237096 Number of extensions: 1902852 Number of successful extensions: 2547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2547 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -