BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30662 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 2.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.9 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 5.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.1 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 2.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 60 TASDTTEKSTAPDTNKSRKFTITF 131 TAS TTE ST T S+K F Sbjct: 383 TASPTTEPSTTTSTTISQKHIKVF 406 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 Query: 83 IDSARYKQIPKIHDYVLNEEYLASQKNRAKLITRIRP 193 + A YK + D+ + E Y AS N L I P Sbjct: 23 VSVAGYKHSRRHRDFTVAESYDASSSNSDSLSMTIPP 59 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 231 DSKITLSATTGSSGLILVMSLALF 160 D + SAT G+SG+ ++++ LF Sbjct: 335 DDPVGASATHGASGIWGIIAIGLF 358 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +2 Query: 335 YQQDIR--IWRCLNTTANVIGASSRVVLSRDGQPRILLCQGY 454 ++QD+ +RC+ +N +G VLSRD Q R ++ Q Y Sbjct: 97 FRQDVHSAAYRCV--ASNSVGR----VLSRDVQVRAVVAQAY 132 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.1 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +2 Query: 335 YQQDIR--IWRCLNTTANVIGASSRVVLSRDGQPRILLCQGY 454 ++QD+ +RC+ +N +G VLSRD Q R ++ Q Y Sbjct: 97 FRQDVHSAAYRCV--ASNSVGR----VLSRDVQVRAVVAQAY 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,702 Number of Sequences: 438 Number of extensions: 4114 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -