BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30657 (724 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P02382 Cluster: Mitochondrial ribosomal protein S5; n=2... 33 7.1 >UniRef50_P02382 Cluster: Mitochondrial ribosomal protein S5; n=2; Trichocomaceae|Rep: Mitochondrial ribosomal protein S5 - Emericella nidulans (Aspergillus nidulans) Length = 410 Score = 33.1 bits (72), Expect = 7.1 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = -3 Query: 302 ELLLATLNFVH*MNKISGTLFFFTLKPNQQSPKYLVFKKKKYLSIIENSIF*RNYQLRKL 123 ++ ++ F H +KI+ TL+ + N+Q YL KKKY S+ IF + QL K Sbjct: 94 KIFISEGEFKHTNDKINITLYVY----NKQKLNYLAKLKKKYTSLFGKDIFIKKLQLIKS 149 Query: 122 QLCG 111 + G Sbjct: 150 KAIG 153 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,506,608 Number of Sequences: 1657284 Number of extensions: 13723697 Number of successful extensions: 25645 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25637 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 58677691418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -