BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30654 (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1064 - 10978039-10978190,10978731-10978865,10979217-109796... 29 2.9 02_05_0795 - 31792231-31794780 29 5.0 03_06_0100 - 31647506-31647664,31647752-31647835,31647933-316480... 28 8.7 >12_01_1064 - 10978039-10978190,10978731-10978865,10979217-10979605, 10979669-10979892,10980011-10980172,10980256-10980906, 10981583-10981804 Length = 644 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 333 NKPCATQLCRYLNFNIYYNTTKTFTQNENYEHFV-KLFP 446 N P A Q CR + ++ +NTT T E + H +LFP Sbjct: 479 NSP-APQPCRIITLDVAFNTTPQITSTEPHPHLPGELFP 516 >02_05_0795 - 31792231-31794780 Length = 849 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +3 Query: 159 IDNANRMDDKPEI*PETLYYKHDNIILQQSINLPDAILGSFKEASESLTRAPSS 320 +D+ +MD E+ E K DNI L PDA G F + T P S Sbjct: 723 VDSPKKMDVNNEVKYEV---KVDNIDLDDLFRTPDAAFGGFSVLHDPSTSEPDS 773 >03_06_0100 - 31647506-31647664,31647752-31647835,31647933-31648089, 31648181-31648446,31648524-31648796,31648874-31648985, 31649112-31649331,31649476-31649899 Length = 564 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 515 VPDLFNTILSIKAIKFKFIDERVWKQFYKMLIVFIL 408 VPD+FNT + + ++ D QFY L +F L Sbjct: 321 VPDVFNTEVHVNRFYMEYYDSGEVSQFYSDLSLFDL 356 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,058,918 Number of Sequences: 37544 Number of extensions: 341078 Number of successful extensions: 654 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -