BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30654 (729 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY095047-1|AAM11375.1| 520|Drosophila melanogaster LD35592p pro... 33 0.30 AE014134-2288|AAF53251.1| 520|Drosophila melanogaster CG5439-PA... 33 0.30 >AY095047-1|AAM11375.1| 520|Drosophila melanogaster LD35592p protein. Length = 520 Score = 33.5 bits (73), Expect = 0.30 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -3 Query: 196 ISGLSSILFALSIDRPELNESQQS--SQVDKVEHVIPLPTPVKSSGNLKR 53 + LS +LFAL++D ELN ++S S K E +I +PV G KR Sbjct: 193 VDSLSDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKR 242 >AE014134-2288|AAF53251.1| 520|Drosophila melanogaster CG5439-PA protein. Length = 520 Score = 33.5 bits (73), Expect = 0.30 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -3 Query: 196 ISGLSSILFALSIDRPELNESQQS--SQVDKVEHVIPLPTPVKSSGNLKR 53 + LS +LFAL++D ELN ++S S K E +I +PV G KR Sbjct: 193 VDSLSDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKR 242 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,333,295 Number of Sequences: 53049 Number of extensions: 628075 Number of successful extensions: 1480 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1480 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3273062859 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -