BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30654 (729 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132904-23|CAC35839.2| 312|Caenorhabditis elegans Hypothetical... 30 1.5 AL132904-7|CAC35838.1| 430|Caenorhabditis elegans Hypothetical ... 30 1.5 >AL132904-23|CAC35839.2| 312|Caenorhabditis elegans Hypothetical protein Y111B2A.10b protein. Length = 312 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 435 KLFPHSFVNKFKFYCLNRQNRVEKVRHSIVFTNQML 542 +LFP + V ++YC NR+ +EK R S + Q L Sbjct: 126 ELFPSTSVKTHEWYCKNREKIIEKQRVSKILKVQSL 161 >AL132904-7|CAC35838.1| 430|Caenorhabditis elegans Hypothetical protein Y111B2A.10a protein. Length = 430 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 435 KLFPHSFVNKFKFYCLNRQNRVEKVRHSIVFTNQML 542 +LFP + V ++YC NR+ +EK R S + Q L Sbjct: 244 ELFPSTSVKTHEWYCKNREKIIEKQRVSKILKVQSL 279 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,581,488 Number of Sequences: 27780 Number of extensions: 344707 Number of successful extensions: 834 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -