BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30654 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 2.9 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 2.9 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 3.9 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 3.9 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 9.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.0 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 366 LNFNIYYNTTKTFTQNENYEHFVKLF 443 L+ N Y+ + N NY ++ KL+ Sbjct: 85 LSNNYNYSNYNNYNNNNNYNNYKKLY 110 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +3 Query: 360 RYLNFNIYYNTTKTFTQNENYEHFVKLFPHSFVN 461 +Y N+N Y N N ++ KL+ + +N Sbjct: 90 KYSNYNNYNNNYNNNYNNNYNNNYKKLYKNYIIN 123 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +3 Query: 360 RYLNFNIYYNTTKTFTQNENYEHFVKLFPHSFVN 461 +Y N+N Y N N ++ KL+ + +N Sbjct: 90 KYSNYNNYNNNYNNNYNNNYNNNYKKLYKNYIIN 123 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +1 Query: 172 IEWMISLKYDQKHCII 219 I+W++S D ++C+I Sbjct: 389 IDWIVSQTPDAEYCVI 404 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 672 PINLEKNMFSYKDSLVPW 619 PINLE S + L+ W Sbjct: 1010 PINLEARALSSSEILITW 1027 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 672 PINLEKNMFSYKDSLVPW 619 PINLE S + L+ W Sbjct: 1006 PINLEARALSSSEILITW 1023 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,079 Number of Sequences: 438 Number of extensions: 4345 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -