BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30649 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 24 1.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 1.4 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 4.3 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 9.9 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 9.9 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 119 PITGQQGVAAAAASIRTPLVSQSSRPANYKYTPN 220 P T ++A TPL+ + +NY YTP+ Sbjct: 8 PSTTTTTTTTSSALNSTPLIEFNISTSNYLYTPS 41 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 119 PITGQQGVAAAAASIRTPLVSQSSRPANYKYTPN 220 P T ++A TPL+ + +NY YTP+ Sbjct: 8 PSTTTTTTTTSSALNSTPLIEFNISTSNYLYTPS 41 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +2 Query: 2 PPVRPSTQAASAYANMQPTYRPAPRAPAQSTIRTSLDA 115 P + S+ + ++ PT P P P + + S DA Sbjct: 78 PSPKRSSPILAEKVSVSPTTPPTPSPPPEERLTPSKDA 115 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 405 NFQKHTSYFPSQIRVHSLNKWKQSFPKHLFLFLEW 301 NF +H + + ++ W ++ P+ L FL W Sbjct: 408 NFDRHYEENRAPLGLYFHAAWLKNNPEFLDAFLYW 442 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 312 TETDAWGTTVSTYSENAP 365 TET WG+ +T E P Sbjct: 257 TETKTWGSVFNTVLELMP 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,890 Number of Sequences: 336 Number of extensions: 3035 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -