BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30648 (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 25 2.7 AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein p... 23 8.2 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 370 YNSTLLCFLYIFFLNNSSLYSKCQNL*LGPGMQNI 266 Y T +C LY+FF+ S+Y + G G+++I Sbjct: 230 YTFTFIC-LYLFFIITLSIYGLMSQISDGFGVKDI 263 >AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein protein. Length = 234 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 486 YRILTSQNRKIAKNF 530 YR+L Q RK+A+N+ Sbjct: 83 YRLLVKQARKLAQNY 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,019 Number of Sequences: 2352 Number of extensions: 11747 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -