BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30645 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 30 0.016 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 23 3.2 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 4.2 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 5.5 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 22 5.5 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 5.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 5.5 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 7.3 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 7.3 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 21 9.7 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 30.3 bits (65), Expect = 0.016 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 324 YKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAD 455 Y +E + + + T DG +V Y + DGS+R V Y+AD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 538 LMMVVLLYRLACFVGAVCLTTALKPLCLSAEYSTT 434 L+ +V L++L F+ ++CL L + STT Sbjct: 4 LLSLVTLWKLTIFLSSMCLDPRLNSKIQVSGASTT 38 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 324 IQMHIWDEHHN 292 + +HI+D HHN Sbjct: 86 VHLHIYDMHHN 96 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 5.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 324 IQMHIWDEHHN 292 + +HI+D HHN Sbjct: 403 VNLHIYDLHHN 413 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = -2 Query: 366 VGSSGPQCEGLRF----CIQMHIWDEHHN 292 +G C GL+ +HI+D HHN Sbjct: 86 LGEDFVTCNGLKLPKSTITHLHIYDLHHN 114 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 5.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 324 IQMHIWDEHHN 292 + +HI+D HHN Sbjct: 403 VNLHIYDLHHN 413 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 199 HHGAPTIHAAPVLVHHH 249 HH IHA +V+HH Sbjct: 324 HHAGHHIHAQHHVVNHH 340 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +2 Query: 428 YPCCGILRRQAQW 466 Y C G++R QW Sbjct: 64 YDCEGVIRHHGQW 76 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.4 bits (43), Expect = 7.3 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +3 Query: 264 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLH 413 ++ + P E+Y H Y Y+ E P+ H + DG V + H Sbjct: 361 YNKNHPNSENYINHQNYVQGYQGEHPNYNHY-GYHYSGDGGEVAHLPNTH 409 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.4 bits (43), Expect = 7.3 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +3 Query: 264 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLH 413 ++ + P E+Y H Y Y+ E P+ H + DG V + H Sbjct: 309 YNKNHPNSENYINHQNYVQGYQGEHPNYNHY-GYHYSGDGGEVAHLPNTH 357 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 21.0 bits (42), Expect = 9.7 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -2 Query: 324 IQMHIWDEHHN 292 +Q+HI+D H+N Sbjct: 87 LQLHIYDLHYN 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,022 Number of Sequences: 336 Number of extensions: 3606 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -