BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30639 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 27 0.12 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 27 0.12 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 27 0.12 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 7.9 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 27.5 bits (58), Expect = 0.12 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 583 HLHGYFEERFSEFLRQRFPILIHKSSITSPNCLLPLNKFV 464 HLH Y EE R R ++ + SS+ P +LP K++ Sbjct: 161 HLHRYKEEALQGDGRMRQHVMHNLSSVPQPQPVLPTYKWM 200 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 27.5 bits (58), Expect = 0.12 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 583 HLHGYFEERFSEFLRQRFPILIHKSSITSPNCLLPLNKFV 464 HLH Y EE R R ++ + SS+ P +LP K++ Sbjct: 161 HLHRYKEEALQGDGRMRQHVMHNLSSVPQPQPVLPTYKWM 200 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 27.5 bits (58), Expect = 0.12 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 583 HLHGYFEERFSEFLRQRFPILIHKSSITSPNCLLPLNKFV 464 HLH Y EE R R ++ + SS+ P +LP K++ Sbjct: 161 HLHRYKEEALQGDGRMRQHVMHNLSSVPQPQPVLPTYKWM 200 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 576 MGISRSGFPNSC 541 MG+ R GF N C Sbjct: 200 MGVHRPGFDNDC 211 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,371 Number of Sequences: 336 Number of extensions: 3571 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -