BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30639 (738 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 28 1.6 SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomy... 27 3.7 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 26 4.9 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 27.9 bits (59), Expect = 1.6 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 183 ERYNH*QIERGFSKKTDTSYLSRQVYLKGKYKASGKLLILPITGDGDTTIKLKNLRIQ 356 E YN + + FS+K L + L+ YK+ G P +G+ DT + RI+ Sbjct: 216 ETYNDPSVPKDFSRKAIHESLRTKNILQSPYKSVGIEEEFPSSGNNDTPGLTDSTRIE 273 >SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 26.6 bits (56), Expect = 3.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 321 DTTIKLKNLRIQMIYPFNLVKNSEGKDVIDLSSYRYSYDVKDNAHFHMTNL 473 + T K LRI+ P+ LVK + K + DL S + D K+ H +L Sbjct: 70 NATFKGSKLRIEEARPYYLVKLQQEKKIADLQS--TNNDEKNEDHSSKVDL 118 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 557 PLLEIPMEMVYNTVKTYLKSQPLEDIANL 643 PLL + ME + + + T LKS P ED L Sbjct: 3130 PLLALTMETMVDQIHTRLKSFPEEDAYRL 3158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,002,971 Number of Sequences: 5004 Number of extensions: 61602 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -