BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30638 (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 95 4e-20 SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 28 5.4 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 28 5.4 SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) 28 5.4 SB_38366| Best HMM Match : Sar8_2 (HMM E-Value=4.1) 28 7.1 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) 28 7.1 SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) 28 7.1 SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54813| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 95.1 bits (226), Expect = 4e-20 Identities = 43/89 (48%), Positives = 62/89 (69%) Frame = +3 Query: 3 GSCVKQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPR 182 GSC+ MK I+A++ V IPD + V VKSR+VTV GPRG LKRNF+HL +++ V Sbjct: 548 GSCLSCIVAMKTILASETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTKVGKD 607 Query: 183 LLKVEKWFGSKKELAAVRTVCSHVRT*LK 269 ++V+ WF S+KELA V+T+ +H+ +K Sbjct: 608 KVRVDVWFASRKELACVKTIITHIENMIK 636 Score = 84.6 bits (200), Expect = 6e-17 Identities = 35/53 (66%), Positives = 44/53 (83%) Frame = +2 Query: 254 KNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAP 412 +NMIKGV G++YKMRAVYAHFPIN E +++E+RNFLGEKY+RRV+M P Sbjct: 632 ENMIKGVIYGYRYKMRAVYAHFPINIAIQENGTLVEVRNFLGEKYVRRVRMRP 684 >SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 508 ESTTVKNKDIRKFLDGLYVSEKTTVV 585 +ST VKNKDIRKFLDG+YVSEKTT+V Sbjct: 6 QSTKVKNKDIRKFLDGVYVSEKTTIV 31 >SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 31.1 bits (67), Expect = 0.76 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +2 Query: 443 KDELIIEGNSLEDVSSSAALIQNLLQSRIRISESSWMVFMYLRKQ 577 K++ + EGNS +D L+Q LL IRI +W + LR + Sbjct: 956 KEQQVFEGNSDQDTVVINDLVQPLLTQHIRICPKTWNEQIALRAE 1000 >SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 191 LQETRVYHANVNSQVFEVPFENSAGPFNCHQ 99 L TR+ + V+S EV E S P++CHQ Sbjct: 160 LYNTRIPNVTVSSDGGEVELEISDDPYDCHQ 190 >SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -2 Query: 244 QTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPRGPLTVT 101 QT++T A F D RRR F+ +S C + L R+P P++ T Sbjct: 85 QTMITTA--FPDTRKSPLTRRRNFSDGVSDLSCTENLARSPCAPVSPT 130 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 12 VKQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRG 125 ++ + +K++ + K K DG+ VH K+ TV+ PRG Sbjct: 98 LQNAKRIKKLEEDLKKKTCDGVLVHRKAVAATVEEPRG 135 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +3 Query: 60 KIPDGLTVHVKSRLVTVKGPRG---VLKRNFKHL-AVDIRMVNPRLLKV 194 K+ DGL VH+ ++ V K P+ + KR + L A+ I + +P + KV Sbjct: 4 KLDDGLRVHIVTQYVLFKNPKKLEIIAKRQKETLEALQINLDHPHVAKV 52 >SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) Length = 197 Score = 28.3 bits (60), Expect = 5.4 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = -1 Query: 182 TRVYHANVNSQVFEVP-------FENSAGPFNCHQTRFHMDRKP 72 TR YH NV VF V F S G N HQ + DR+P Sbjct: 57 TRSYHENVVRPVFGVSDYWYRYEFAKSRGQINRHQLSWREDRQP 100 >SB_38366| Best HMM Match : Sar8_2 (HMM E-Value=4.1) Length = 129 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -2 Query: 268 FNHVLTCEQTVLTAASSFLDPNHFSTFRRRGF-TMRMSTAKCLKFLLRTPRGPLTVT 101 F +L V+ S F P+H FR GF +R+S +K++ + + + +T Sbjct: 9 FRLILILSLLVVFVTSIFACPSHQHDFREEGFGVVRISVRSSVKWITKEKKSLIGIT 65 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 44 SKSESQNPRRAYGPCEIASGDS*RAPRS--SQKELQTL 151 S+ ++ R Y PC I SG++ APR +KE++ L Sbjct: 1363 SEDDTTTGARRYRPCPIESGNTYEAPRQVVMEKEVEEL 1400 >SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) Length = 309 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -3 Query: 468 LPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIE 349 +P I S G+L +T G I T PKKL +IE Sbjct: 218 IPIAIGSKVNLGQLNILTAGPIITANTSGDPKKLANQVIE 257 >SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) Length = 1152 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 87 VKSRLVTVKGPRGVLKRNFKHL 152 V++R TV PRG L+RN +HL Sbjct: 1069 VETRSYTVSTPRGELRRNRRHL 1090 >SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -3 Query: 498 AAELETSSKELPSMISSSFCFGELTTVTPGAIFTLLMYFSPKKLRISIIEL 346 AAE++TS L + S S C VT IFT MY P+++ ++ L Sbjct: 234 AAEVKTSRIFLLVINSFSICLAPFMIVTFIEIFTGTMYTVPRQVYLATTNL 284 >SB_54813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 27.5 bits (58), Expect = 9.4 Identities = 21/80 (26%), Positives = 33/80 (41%) Frame = -3 Query: 405 IFTLLMYFSPKKLRISIIELPSVVTQLMGK*AYTARILYWKPLVTPLIMFLHVNRLSSRR 226 IF+ + ++P+K + +I+ LP + + A L WKP L L + S Sbjct: 18 IFSRVSGYTPRKRKTAILALPFLARPKWRPFGFVAFPLRWKPTERLLRRLLGLAARDSNN 77 Query: 225 QAPFWIRTISQPSGDEGLPC 166 + I P GD PC Sbjct: 78 TSVLPI----APGGDTADPC 93 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,911,863 Number of Sequences: 59808 Number of extensions: 415153 Number of successful extensions: 1132 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1131 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -