BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30636 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 3.5 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 3.5 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 8.1 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 8.1 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 229 NNNHILNEGSHFSNASLETRRPMDLL 152 +NN I HFS++S +R+ + +L Sbjct: 245 SNNVIAERKKHFSSSSYSSRKRLAML 270 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 229 NNNHILNEGSHFSNASLETRRPMDLL 152 +NN I HFS++S +R+ + +L Sbjct: 245 SNNVIAERKKHFSSSSYSSRKRLAML 270 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +2 Query: 530 PPNILRTIANTVTGKSNVSSTLPSGQLSNVPWEKVRC 640 P +L + ++ GK+ + +TL SN+ +RC Sbjct: 103 PGELLAILGSSGAGKTTLLNTLTFHTSSNLTVSGLRC 139 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +2 Query: 530 PPNILRTIANTVTGKSNVSSTLPSGQLSNVPWEKVRC 640 P +L + ++ GK+ + +TL SN+ +RC Sbjct: 103 PGELLAILGSSGAGKTTLLNTLTFHTSSNLTVSGLRC 139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,259 Number of Sequences: 336 Number of extensions: 4265 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -