BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30634 (387 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-35|CAB16518.2| 524|Caenorhabditis elegans Hypothetical p... 27 4.6 U41279-5|AAK31424.2| 161|Caenorhabditis elegans Hypothetical pr... 27 6.1 >Z99281-35|CAB16518.2| 524|Caenorhabditis elegans Hypothetical protein Y57G11C.17 protein. Length = 524 Score = 27.1 bits (57), Expect = 4.6 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 99 PTTPGNLPKSIRAN--EIYLRKSLPS*LVATWVSCSRRK 209 P+ PG LPK+ RA +++ SL + ++A WVS + K Sbjct: 8 PSIPGPLPKAERALAWSVWIFHSLFAFVIAYWVSNGKAK 46 >U41279-5|AAK31424.2| 161|Caenorhabditis elegans Hypothetical protein C17C3.11 protein. Length = 161 Score = 26.6 bits (56), Expect = 6.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 116 PSKIDKSKRDLFKKITSKLIGRNVGQLFK 202 P+ IDK + D F I KL+G+++ K Sbjct: 76 PTLIDKGRHDNFNYIVMKLLGKSLQDAIK 104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,501,210 Number of Sequences: 27780 Number of extensions: 152839 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -