BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30633 (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0210 - 15617770-15618453 31 0.94 11_06_0442 - 23622633-23623000,23623149-23623721,23624795-236253... 28 8.7 >12_02_0210 - 15617770-15618453 Length = 227 Score = 31.1 bits (67), Expect = 0.94 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +3 Query: 543 DNAFLHNGITSGLRSLSVDFILPCSESYVYITDDTTRDLIGLLASGLAF-TKIQPRQVI 716 DNA N I+ +S +V L ++SY T T + G AF T++QPRQ I Sbjct: 158 DNAAWQNEISFLRKSRNVSSKLGTTQSYTVTTVIATWSSAWAIVCGFAFCTRVQPRQAI 216 >11_06_0442 - 23622633-23623000,23623149-23623721,23624795-23625335, 23625807-23625982,23626081-23626804 Length = 793 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 457 IPGIRKQVKPAALLLFNNMKNNRISGKTSTMLF-STTVSLVD 579 IP + KP L++ N++NN +SG+ LF STT S +D Sbjct: 80 IPQLLGSNKP---LIWVNLQNNSLSGEIPPSLFNSTTTSYID 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,790,744 Number of Sequences: 37544 Number of extensions: 317350 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -