BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30633 (729 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC053509-1|AAH53509.1| 656|Homo sapiens 5,10-methylenetetrahydr... 33 0.79 AY338232-1|AAP88033.1| 656|Homo sapiens 5,10-methylenetetrahydr... 33 0.79 AL953897-14|CAI15889.1| 697|Homo sapiens 5,10-methylenetetrahyd... 33 0.79 AL953897-10|CAI15885.1| 656|Homo sapiens 5,10-methylenetetrahyd... 33 0.79 AJ237672-1|CAB41971.1| 679|Homo sapiens methylenetetrahydrofola... 33 0.79 AF105987-1|AAD17965.1| 656|Homo sapiens methylenetetrahydrofola... 33 0.79 AB209113-1|BAD92350.1| 672|Homo sapiens 5,10-methylenetetrahydr... 33 0.79 >BC053509-1|AAH53509.1| 656|Homo sapiens 5,10-methylenetetrahydrofolate reductase (NADPH) protein. Length = 656 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 226 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 268 >AY338232-1|AAP88033.1| 656|Homo sapiens 5,10-methylenetetrahydrofolate reductase (NADPH) protein. Length = 656 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 226 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 268 >AL953897-14|CAI15889.1| 697|Homo sapiens 5,10-methylenetetrahydrofolate reductase (NADPH) protein. Length = 697 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 267 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 309 >AL953897-10|CAI15885.1| 656|Homo sapiens 5,10-methylenetetrahydrofolate reductase (NADPH) protein. Length = 656 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 226 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 268 >AJ237672-1|CAB41971.1| 679|Homo sapiens methylenetetrahydrofolate reductase protein. Length = 679 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 249 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 291 >AF105987-1|AAD17965.1| 656|Homo sapiens methylenetetrahydrofolate reductase protein. Length = 656 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 226 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 268 >AB209113-1|BAD92350.1| 672|Homo sapiens 5,10-methylenetetrahydrofolate reductase (NADPH) variant protein. Length = 672 Score = 33.5 bits (73), Expect = 0.79 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 548 IVDVFPEMRLFFILLKSSNAAGLTCFLIPGISRYPVSTNHILEQI 414 I +F E FF +K+ G+TC ++PGI +P+ H L Q+ Sbjct: 256 ITQLFFEADTFFRFVKACTDMGITCPIVPGI--FPIQGYHSLRQL 298 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,675,074 Number of Sequences: 237096 Number of extensions: 1820387 Number of successful extensions: 7090 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7090 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8623170556 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -