BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30626 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 67 1e-13 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 67 1e-13 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 62 5e-12 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 1.9 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.6 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.4 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.8 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 67.3 bits (157), Expect = 1e-13 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 573 INEPTAAAIAYGLDKKGTGERNVLIFDLGGG*PFDVSILYHSKDGIF 713 INEPTAAAIAYGLDKK ERNVLIFDLGGG FDVS+L ++GIF Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGG-TFDVSLL-TIEEGIF 45 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 67.3 bits (157), Expect = 1e-13 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 573 INEPTAAAIAYGLDKKGTGERNVLIFDLGGG*PFDVSILYHSKDGIF 713 INEPTAAAIAYGLDKK ERNVLIFDLGGG FDVS+L ++GIF Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGG-TFDVSLL-TIEEGIF 45 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 62.1 bits (144), Expect = 5e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 573 INEPTAAAIAYGLDKKGTGERNVLIFDLGGG*PFDVSIL 689 INEPTAAAIAYGLDKKG E+N+L++DLGGG FDVSIL Sbjct: 1 INEPTAAAIAYGLDKKG-AEQNILVYDLGGG-TFDVSIL 37 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +3 Query: 459 SWQNCAECSYHGSRVLHDS----QRQATKDAGTISGLNVLRIINEPTAA 593 +W E +G+ LH S TKDAG +S + ++N+P A Sbjct: 303 AWAMDDESDINGTPPLHISGPAEAGPLTKDAGLLSYPEICTLLNDPQNA 351 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 346 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 471 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 118 LPAREGGDHRQRPGQQDH 171 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -1 Query: 308 CTVASSNLRPMRRLASNICCWGSSPP 231 CT + N R R I C ++PP Sbjct: 14 CTYGNVNYRQRRSQPLKISCLKTTPP 39 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,549 Number of Sequences: 336 Number of extensions: 4155 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -