BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30626 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 102 1e-23 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 1.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.2 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 102 bits (244), Expect = 1e-23 Identities = 51/61 (83%), Positives = 55/61 (90%) Frame = +3 Query: 507 HDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGG*PFDVSI 686 +DSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDLGGG FDVSI Sbjct: 11 NDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGG-TFDVSI 69 Query: 687 L 689 L Sbjct: 70 L 70 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.8 bits (54), Expect = 1.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 724 FHLRKIPSFEW*RMDTSKGYPPPRSKISTFRSPVPFL 614 FH+ + F+ +T++ Y P + IS PVPFL Sbjct: 774 FHVPSLYGFQQVVNNTNRLYTPQLNHISMRMPPVPFL 810 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 58 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 159 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,557 Number of Sequences: 2352 Number of extensions: 18564 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -