BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30625 (671 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19442| Best HMM Match : Beach (HMM E-Value=0) 31 1.1 SB_14892| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 >SB_19442| Best HMM Match : Beach (HMM E-Value=0) Length = 796 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 380 SKAPPIL*ALDFQMWPKLRTPF 315 SK PPI AL Q+WP++R F Sbjct: 775 SKTPPIKPALQLQVWPQIRAQF 796 >SB_14892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +3 Query: 93 KEEYNQSQNGTENFRVHVNGLVIAMMPAESFAESLLSAMPDL--EELLESEGINQLNNKS 266 KE+ SQ + + G +I +PA +F + L L +ELL + GI+ L S Sbjct: 132 KEQVAASQRSMKGYLYDAQGKIIQSIPATNFKKPGLGQADKLTVQELLNAAGIDSLEQPS 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,020,840 Number of Sequences: 59808 Number of extensions: 294288 Number of successful extensions: 919 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -