Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30625
         (671 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    25   1.6  

>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative
           cell-adhesion protein protein.
          Length = 1881

 Score = 25.4 bits (53), Expect = 1.6
 Identities = 11/53 (20%), Positives = 25/53 (47%)
 Frame = +3

Query: 99  EYNQSQNGTENFRVHVNGLVIAMMPAESFAESLLSAMPDLEELLESEGINQLN 257
           +Y+Q +NGT    +H    +  ++P  +  E+          +L+ E + +L+
Sbjct: 429 DYDQGKNGTFRLSLHPPSDIFEVIPKRAINEATFGLRVKDPSMLDYERVRELS 481


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 579,453
Number of Sequences: 2352
Number of extensions: 10734
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 67322955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)