BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30622 (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomy... 29 0.65 SPAC20H4.04 |mfh2||ATP-dependent 3' to 5' DNA helicase |Schizosa... 29 0.65 SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 28 1.1 SPAC589.04 |||metaxin 1|Schizosaccharomyces pombe|chr 1|||Manual 27 2.0 SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc... 27 3.5 SPAC1805.05 |cki3||serine/threonine protein kinase Cki3|Schizosa... 26 6.1 SPBC19C2.11c |||mitochondrial outer membrane protein |Schizosacc... 26 6.1 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 25 8.0 >SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 29.1 bits (62), Expect = 0.65 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +2 Query: 344 EEKPQTESEVLATSENPKPTESAAPLSDISIKSDTPHNKEASVNKQKRPQ 493 E+ S++ S++ KP E AP S +IK+D P N N ++ Q Sbjct: 336 EQSIDVSSDIGLRSDSSKPNE--APTSSENIKADQPENSTKQENPEEDMQ 383 >SPAC20H4.04 |mfh2||ATP-dependent 3' to 5' DNA helicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 29.1 bits (62), Expect = 0.65 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 170 KFSGSRKRASHRHDAGRVVCRIIIVSDAHLEELLESEGINQLQQQ 304 K+S S K + + + C +++S AH+ LL+ GI Q Q+ Sbjct: 361 KYSFSSKNVQSKEKSKIMSCFTLLISCAHITYLLDCHGIIQFYQK 405 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 28.3 bits (60), Expect = 1.1 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 344 EEKPQTESEVLATSENPKPTESAAPLS--DISIKSDTPHNKEASVNKQKRPQRLKSMWLV 517 +++ +T L E T+S A L D ++D+ N+E + K+K + L WL Sbjct: 3 QKETKTSQIALVDGEKLSITDSFASLFTLDEEEENDSVDNEEIKLTKEKHEKLLLLFWLH 62 Query: 518 CCCP 529 C P Sbjct: 63 CKFP 66 >SPAC589.04 |||metaxin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 27.5 bits (58), Expect = 2.0 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -1 Query: 452 VVYLILWRYRSKAPPI-L*ALDFQMWPKLRTPFEVFLQA*AER*PSEVSAFV 300 V+YL +W + + + +L +Q W KL P VFL P E F+ Sbjct: 39 VMYLTMWNSDLNSEALDVNSLQWQTWAKLNDPSIVFLNVSNHASPDEKVPFI 90 >SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1458 Score = 26.6 bits (56), Expect = 3.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 416 PLSDISIKSDTPHNKEASVNKQKRPQRLKS 505 P SD SIKS +E+S +++K P +S Sbjct: 182 PESDQSIKSSRNRRRESSFSREKNPDLTRS 211 >SPAC1805.05 |cki3||serine/threonine protein kinase Cki3|Schizosaccharomyces pombe|chr 1|||Manual Length = 439 Score = 25.8 bits (54), Expect = 6.1 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +2 Query: 344 EEKPQTESEVLATSENPKPTESAAPLSDISIKSDTPHNKEASVNKQKRPQRLKSMWLVCC 523 +++ QT S A + P+ E AP + + DT + + +K+K ++ L CC Sbjct: 378 QQQQQTSS---AQQQQPQRVEQPAPQTTQPTQVDTQQAAKPAPSKEKSRKKFHLRLLSCC 434 >SPBC19C2.11c |||mitochondrial outer membrane protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.8 bits (54), Expect = 6.1 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +2 Query: 350 KPQTESEVLATSENPKPTESAAPLSDISIKSDTPHNKEASVNKQKRPQRLKSMWL 514 K + SE S+N TESA SI DTP ++NK KR + + WL Sbjct: 364 KSASSSETFVGSKNVDLTESAFD----SIP-DTPTKIITNINKLKRNYTITNNWL 413 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 365 SEVLATSENPKPTESAAPLSDISIKSDTPHN 457 S + +S + SAA +D S+ +DTP N Sbjct: 1129 SSTVTSSATASSSSSAATTADSSVTTDTPSN 1159 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,460,392 Number of Sequences: 5004 Number of extensions: 45159 Number of successful extensions: 137 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -